FOXO4-DRI
Based on 1 publication(s) in Google Scholar
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.96%
- No. CAS: 2460055-10-9
- Fòrmula: C228H388N86O64
- Peso molecular:5358.06
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Pureza y Documentación
- Referencias
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) FOXO4-DRI
More
Actividad biológica
FOXO4-DRI (25 mM; 3 days) causes nuclear exclusion of active p53 and induces apoptosis in senescent TM3 Leydig cells[1].
FOXO4-DRI (25 μM; 5 days) significantly reduces the senescence level in PDL9 cells[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Senescent Leydig cells
-
Concentration:25 mM
-
Incubation Time:3 days
-
Result:Reduced the viability of senescent as compared to normal TM3 Leydig cells.
-
Cell Line:Senescent Leydig cells
-
Concentration:25 mM
-
Incubation Time:3 days
-
Result:The apoptosis rate increased from 10% to 27%.
-
Cell Line:PDL9 cells
-
Concentration:25 μM
-
Incubation Time:5 days
-
Result:Decreased the protein levels of representative senescent markers, including p16, p21, and p53.
-
Cell Line:PDL9 cells
-
Concentration:25 μM
-
Incubation Time:5 days
-
Result:Enhanced SOX9 expression, and reduced MMP12 and MMP13 expression.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Naturally aged male C57BL/6 mice (20-24 months old)[1]
-
Dosage:5 mg/kg
-
Administration:Intraperitoneal injection, every other day for three administrations
-
Result:Increased serum testosterone levels. Increased levels of both 3β-HSD and CYP11A1. Decreased interstitial SA-β-gal activity and lowered levels of senescence-associated proteins p53, p21, and p16. Decreased the levels of IL-1β, IL-6 and TGF-β.
Chemical Information
-
No. CAS 2460055-10-9
-
Appearance Solid
-
Peso molecular 5358.06
-
Fòrmula C228H388N86O64
-
Color White to off-white
-
Sequence
D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly)
-
Sequence Shortening
D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvente y solubilidad
H2O : 100 mg/mL (18.66 mM; Need ultrasonic)
DMSO : 50 mg/mL (9.33 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureza y Documentación
-
Ficha de datos (295 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Zhang C, et al. FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging (Albany NY). 2020 Jan 20;12(2):1272-1284. [Content Brief]
[2]. Huang Y, et al. Senolytic Peptide FOXO4-DRI Selectively Removes Senescent Cells From in vitro Expanded Human Chondrocytes. Front Bioeng Biotechnol. 2021 Apr 29;9:677576. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.1866 mL | 0.9332 mL | 1.8663 mL | 4.6659 mL |
| 5 mM | 0.0373 mL | 0.1866 mL | 0.3733 mL | 0.9332 mL | |
| H2O | 10 mM | 0.0187 mL | 0.0933 mL | 0.1866 mL | 0.4666 mL |
| 15 mM | 0.0124 mL | 0.0622 mL | 0.1244 mL | 0.3111 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
FOXO4-DRI Related Classifications
HY-P4157 Related Classifications
Powered by Bioz