(Pro3) GIP, human TFA
Based on 1 Customer Validation
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 99.89%
- 화학식: C226H338N60O64S.xC2HF3O2
- 분자량:4951.53 (free base)
-
보관:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
용액&용해도
- 순도&문서
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
Appearance Solid
-
분자량 4951.53 (free base)
-
화학식 C226H338N60O64S.xC2HF3O2
-
Color White to off-white
-
SMILES
O=C([C@@H](N)CC1=CC=C(O)C=C1)N[C@H](C(N2[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(O)=O)CCC(N)=O)=O)[C@@H](C)O)=O)[C@H](CC)C)=O)CC(N)=O)=O)CC3=CNC=N3)=O)CCCCN)=O)CC4=CNC5=CC=CC=C45)=O)CC(O)=O)=O)CC(N)=O)=O)CCCCN)=O)CCCCN)=O)=O)CCCCN)=O)CCC(N)=O)=O)C)=O)CC(C)C)=O)CC(C)C)=O)CC6=CNC7=CC=CC=C67)=O)CC(N)=O)=O)C(C)C)=O)CC8=CC=CC=C8)=O)CC(O)=O)=O)CCC(N)=O)=O)CCC(N)=O)=O)CC9=CNC=N9)=O)[C@H](CC)C)=O)CCCCN)=O)CC(O)=O)=O)CCSC)=O)C)=O)[C@H](CC)C)=O)CO)=O)CC%10=CC=C(O)C=C%10)=O)CC(O)=O)=O)CO)=O)[C@H](CC)C)=O)CC%11=CC=CC=C%11)=O)[C@@H](C)O)=O)=O)CCC2)=O)C.OC(C(F)(F)F)=O.[x]
-
Synonyms
(Pro3) Gastric Inhibitory Peptide, human TFA
-
Sequence
Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
-
Sequence Shortening
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
용액&용해도
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
순도&문서
-
Data Sheet (266 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005, 54, 8. [Content Brief]
[2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016, 173, 1. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
(Pro3) GIP, human TFA Related Classifications
HY-P3584A Related Classifications
Powered by Bioz