S100B Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.
Background
S100B, a small zinc- and calcium-binding protein highly expressed in astrocytes and abundant in the brain, possesses distinct binding sites for calcium and zinc with varying affinities. While weakly binding calcium, it exhibits tight binding to zinc. Physiological concentrations of potassium ion can antagonize the binding of both divalent cations, particularly affecting high-affinity calcium-binding sites. Functionally, S100B acts as a neurotrophic factor, promoting astrocytosis and axonal proliferation. It also plays a role in the innervation of thermogenic adipose tissue, acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation. S100B initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Post-myocardial infarction, its interaction with AGER may contribute to myocyte apoptosis through the activation of ERK1/2 and p53/TP53 signaling. Additionally, S100B could aid in ATAD3A cytoplasmic processing, preventing aggregation and facilitating mitochondrial localization. Its role extends to mediating calcium-dependent regulation in various physiological processes by interacting with proteins like TPR-containing proteins, modulating their activity. Structurally, S100B forms dimers composed of either two alpha chains, two beta chains, or one alpha and one beta chain, interacting with a multitude of proteins, including CACYBP, ATAD3A, S100A6, CAPZA1, PPP5C, TPPP, and CLSTN3beta, influencing diverse cellular functions.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P50114 (M1-E92)
-
Molecular Construction
-
N-term
-
S100B (M1-E92)
Accession # P50114 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100B; S100 Calcium-Binding Protein B; S100 Calcium Binding Protein B; S100 Calcium-Binding Protein; S100beta; S-100 Protein Beta Chain; S-100 Protein Subunit Beta; Protein S100; Protein S100-B; S100-B; S100 Calcium Binding Protein, Beta (Neural); S100; S
-
AA Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
-
Predicted Molecular Mass
11.8 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)