S961
Based on 9 publication(s) in Google Scholar
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.
For research use only. We do not sell to patients.
- Purity: 99.98%
- CAS No.: 1083433-49-1
- Formula: C211H295N55O71S2
- Molecular Weight:4802.12
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) S961
More- Nature. 2026 Jun;654(8120):1065-1075. [Abstract]
- Nat Commun. 2026 Jun 9;17(1):5068.
- Neuron. 2026 Jun 10:S0896-6273(26)00384-3. [Abstract]
- Neural Regen Res. 2021 Dec;16(12):2465-2474. [Abstract]
- Neuropharmacology. 2023 Nov 1:238:109649. [Abstract]
- Bioconjug Chem. 2022 May 18;33(5):892-906. [Abstract]
- bioRxiv. 2025 Aug 24:2025.08.23.671589. [Abstract]
- SSRN. 2024 Dec 31.
- J Womens Health Dev. 2023;6(2):56-67. [Abstract]
Biological Activity
S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 1083433-49-1
-
Appearance Solid
-
Molecular Weight 4802.12
-
Formula C211H295N55O71S2
-
Color White to off-white
-
Sequence
Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40)
-
Sequence Shortening
GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (9)
-
Journal Impact Factor
-
Most Recent
-
Nature
2026 Jun;654(8120):1065-1075. PMID: 42056521 -
-
Neuron
2026 Jun 10:S0896-6273(26)00384-3. PMID: 42269609 -
Neural Regen Res
Hippocampal insulin resistance and the Sirtuin 1 signaling pathway in diabetes-induced cognitive dysfunction. [Abstract]2021 Dec;16(12):2465-2474. PMID: 33907035 -
Neuropharmacology
Insulin potentiates inhibitory synaptic currents between fast-spiking and pyramidal neurons in the rat insular cortex. [Abstract]2023 Nov 1:238:109649. PMID: 37393988 -
Bioconjug Chem
Design, Synthesis, and Preliminary Evaluation of [68Ga]Ga-NOTA-Insulin as a PET Probe in an Alzheimer's Disease Mouse Model. [Abstract]2022 May 18;33(5):892-906. PMID: 35420782 -
bioRxiv
2025 Aug 24:2025.08.23.671589. PMID: 40894704 -
-
J Womens Health Dev
Placental Fatty Acid Metabolism and Transport in a Rat Model of Gestational Diabetes Mellitus. [Abstract]2023;6(2):56-67. PMID: 37288271
Solvent & Solubility
DMSO : ≥ 50 mg/mL (10.41 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2082 mL | 1.0412 mL | 2.0824 mL | 5.2060 mL |
| 5 mM | 0.0416 mL | 0.2082 mL | 0.4165 mL | 1.0412 mL | |
| 10 mM | 0.0208 mL | 0.1041 mL | 0.2082 mL | 0.5206 mL |