S961 TFA
Based on 9 publication(s) in Google Scholar
S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.
For research use only. We do not sell to patients.
- Formula: C211H295N55O71S2.xC2HF3O2
- Molecular Weight:4802.12 (free acid)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) S961 TFA
More- Nature. 2026 Jun;654(8120):1065-1075. [Abstract]
- Nat Commun. 2026 Jun 9;17(1):5068.
- Neuron. 2026 Jun 10:S0896-6273(26)00384-3. [Abstract]
- Neural Regen Res. 2021 Dec;16(12):2465-2474. [Abstract]
- Neuropharmacology. 2023 Nov 1:238:109649. [Abstract]
- Bioconjug Chem. 2022 May 18;33(5):892-906. [Abstract]
- bioRxiv. 2025 Aug 24:2025.08.23.671589. [Abstract]
- SSRN. 2024 Dec 31.
- J Womens Health Dev. 2023;6(2):56-67. [Abstract]
Biological Activity
Description
In Vitro
S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4802.12 (free acid)
-
Formula C211H295N55O71S2.xC2HF3O2
-
Color White to off-white
-
Sequence
Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40)
-
Sequence Shortening
GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (9)
-
Journal Impact Factor
-
Most Recent
-
Nature
2026 Jun;654(8120):1065-1075. PMID: 42056521 -
-
Neuron
2026 Jun 10:S0896-6273(26)00384-3. PMID: 42269609 -
Neural Regen Res
Hippocampal insulin resistance and the Sirtuin 1 signaling pathway in diabetes-induced cognitive dysfunction. [Abstract]2021 Dec;16(12):2465-2474. PMID: 33907035 -
Neuropharmacology
Insulin potentiates inhibitory synaptic currents between fast-spiking and pyramidal neurons in the rat insular cortex. [Abstract]2023 Nov 1:238:109649. PMID: 37393988 -
Bioconjug Chem
Design, Synthesis, and Preliminary Evaluation of [68Ga]Ga-NOTA-Insulin as a PET Probe in an Alzheimer's Disease Mouse Model. [Abstract]2022 May 18;33(5):892-906. PMID: 35420782 -
bioRxiv
2025 Aug 24:2025.08.23.671589. PMID: 40894704 -
-
J Womens Health Dev
Placental Fatty Acid Metabolism and Transport in a Rat Model of Gestational Diabetes Mellitus. [Abstract]2023;6(2):56-67. PMID: 37288271
Solvent & Solubility
In Vitro:
H2O : 6.5 mg/mL (ultrasonic and adjust pH to 12 with NaOH)
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)