GLP-1 moiety from Dulaglutide
Based on 1 Customer Validation
GLP-1 moiety from Dulaglutide ([Gly8,36,Glu22]-GLP-1 (7-37)) is a 31-amino acid fragment derived from Dulaglutide (HY-P0120). GLP-1 moiety from Dulaglutide is a DPP-4-modified GLP-1 analog carrying the [Gly8,36,Glu22] sequence mutation, which acts as a GLP-1 receptor agonist. GLP-1 moiety from Dulaglutide covalently links to the human IgG4 Fc fragment and constitutes a part of the dulaglutide recombinant fusion protein. GLP-1 moiety from Dulaglutide exhibits glucose-dependent insulinotropic activity. GLP-1 moiety from Dulaglutide can be used in research related to type 2 diabetes.
For research use only. We do not sell to patients.
- Purity : 99.60%
- CAS No.: 1197810-60-8
- Formula: C149H221N37O49
- Molecular Weight:3314.62
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
GLP-1 moiety from Dulaglutide ([Gly8,36,Glu22]-GLP-1 (7-37)), when incorporated into the optimized dulaglutide GLP-1-Fc fusion protein expressed in HEK293-EBNA cells, contributes to a 4-fold greater in vitro activity than the corresponding free DPP-4-protected GLP-1 analog[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 1197810-60-8
-
Appearance Solid
-
Molecular Weight 3314.62
-
Formula C149H221N37O49
-
Color White to off-white
-
Synonyms
[Gly8,36,Glu22]-GLP-1 (7-37)
-
Sequence Shortening
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 1.96 mg/mL (0.59 mM; ultrasonic and adjust pH to 2 with 1 M HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : < 0.1 mg/mL (insoluble)
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Celeste A, et al. Anti-PCSK9-GLP-1 fusions and methods for use. US20160369010 A1. 2016 Dec 22.
[2]. Xi L, et al. Dulaglutide accelerates diabetic wound healing by suppressing Nrf2-dependent ferroptosis in diabetic mice. Peptides. 2025 Mar;185:171366. [Content Brief]
[3]. Wang R, et al. Dulaglutide Alleviates LPS-Induced Injury in Cardiomyocytes. ACS omega. 2021 Mar 30;6(12):8271-8278. [Content Brief]
[4]. Jimenez-Solem E, et al. Dulaglutide, a long-acting GLP-1 analog fused with an Fc antibody fragment for the potential treatment of type 2 diabetes. Current opinion in molecular therapeutics. 2010 Dec;12(6):790-7. [Content Brief]
[5]. Lorenz M, et al. Recent progress and future options in the development of GLP-1 receptor agonists for the treatment of diabesity. Bioorganic & medicinal chemistry letters. 2013 Jul 15;23(14):4011-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)