1. GPCR/G Protein
  2. Glucagon Receptor

GLP-1 moiety from Dulaglutide 

Cat. No.: HY-P1348 Purity: 96.23%
Handling Instructions

GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-1 moiety from Dulaglutide Chemical Structure

GLP-1 moiety from Dulaglutide Chemical Structure

Size Price Stock Quantity
1 mg USD 420 In-stock
Estimated Time of Arrival: December 31
5 mg USD 1320 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Other Forms of GLP-1 moiety from Dulaglutide:

  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.

Solvent & Solubility
In Vitro: 

10 mM in DMSO

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3017 mL 1.5085 mL 3.0169 mL
5 mM 0.0603 mL 0.3017 mL 0.6034 mL
10 mM 0.0302 mL 0.1508 mL 0.3017 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

3314.62

Formula

C₁₄₉H₂₂₁N₃₇O₄₉

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1 moiety from Dulaglutide
Cat. No.:
HY-P1348
Quantity:

GLP-1 moiety from Dulaglutide

Cat. No.: HY-P1348