APETx2 TFA
Based on 1 Customer Validation
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.
For research use only. We do not sell to patients.
- Purity: 99.57%
- Formula: C198H281F3N54O62S6
- Molecular Weight:4675.02
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Biological Activity
Description
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4675.02
-
Formula C198H281F3N54O62S6
-
Color White to off-white
-
Sequence
Gly-Thr-Ala-Cys-Ser-Cys-Gly-Asn-Ser-Lys-Gly-Ile-Tyr-Trp-Phe-Tyr-Arg-Pro-Ser-Cys-Pro-Thr-Asp-Arg-Gly-Tyr-Thr-Gly-Ser-Cys-Arg-Tyr-Phe-Leu-Gly-Thr-Cys-Cys-Thr-Pro-Ala-Asp (Disulfide bridge:Cys4-Cys37;Cys6-Cys30;Cys20-Cys38)
-
Sequence Shortening
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD (Disulfide bridge:Cys4-Cys37;Cys6-Cys30;Cys20-Cys38)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Purity & Documentation
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sylvie Diochot, et al. A New Sea Anemone Peptide, APETx2, Inhibits ASIC3, a Major Acid-Sensitive Channel in Sensory Neurons. EMBO J. 2004 Apr 7;23(7):1516-25. [Content Brief]
[2]. Jerzy Karczewski, et al. Reversal of Acid-Induced and Inflammatory Pain by the Selective ASIC3 Inhibitor, APETx2. Br J Pharmacol. 2010 Oct;161(4):950-60. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)