GpTx-1
GpTx-1 is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 1661050-12-9
- Formel: C176H271N53O45S7
- Molecular Weight:4073.82
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
|
Nav1.3 0.0203 μM (IC50) |
Nav1.4 0.301 μM (IC50) |
Nav1.5 4.20 μM (IC50) |
Nav1.7 10 nM (IC50) |
Nav1.8 12.2 μM (IC50) |
Chemical Information
-
CAS. Nr. 1661050-12-9
-
Molecular Weight 4073.82
-
Formel C176H271N53O45S7
-
Sequence
Asp-Cys-Leu-Gly-Phe-Met-Arg-Lys-Cys-Ile-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Thr-His-Lys-Trp-Cys-Lys-Tyr-Val-Phe-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
-
Sequence Shortening
DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)