RVG-Cys
Based on 1 Customer Validation
RVG-Cys (RVG29-Cys) is a peptide derived from rabies virus glycoprotein (RVG29) with Cys attached to facilitate subsequent conjugation. RVG-Cys enhances the specific targeted delivery of proteins in brain tissue and neurons.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.95%
- No. CAS: 1186105-01-0
- Fòrmula: C144H222N44O44S3
- Peso molecular:3369.77
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
miR-NP-RVG (RVG29-cys incubated with miR-NPs for 48 hours) (2 mg/kg, i.v., 3 times for 7 days) promotes axonal regeneration and functional recovery in a rat spinal cord injury (SCI) model[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Athymic nude mice (6-week-old male mice)[1]
-
Dosage:5 mg/kg RVG29-Cys coupled to chitosan Pluronic-based nano-carriers
-
Administration:Intravenous injection (i.v.), once
-
Result:Increased brain tissue β-galactosidase activity.
Prolonged the accumulation time in the brain.
-
Animal Model:Rat SCI model (Female Wistar rats, weighing 210 ± 10 g)[2]
-
Dosage:2 mg/kg miR-NP-RVG
-
Administration:Intravenous injection (i.v.), 3 times for 7 days
-
Result:Down-regulated the expression of miR-323-5p in residual neurons.
Increased the density of nerve fibers.
Chemical Information
-
No. CAS 1186105-01-0
-
Appearance Solid
-
Peso molecular 3369.77
-
Fòrmula C144H222N44O44S3
-
Color White to off-white
-
Synonyms
RVG29-Cys; RDP-Cys; Rabies Virus Glycoprotein-29-Cys
-
Sequence
Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys
-
Sequence Shortening
YTIWMPENPRPGTPCDIFTNSRGKRASNGC
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvente y solubilidad
H2O : ≥ 100 mg/mL (29.68 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureza y Documentación
-
Ficha de datos (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Kim JY, et al. Brain-targeted delivery of protein using chitosan- and RVG peptide-conjugated, pluronic-based nano-carrier. Biomaterials. 2013 Jan;34(4):1170-8. [Content Brief]
[2]. Li C, et al. miR-NPs-RVG promote spinal cord injury repair: implications from spinal cord-derived microvascular endothelial cells. J Nanobiotechnology. 2024 Sep 28;22(1):590. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2968 mL | 1.4838 mL | 2.9676 mL | 7.4189 mL |
| 5 mM | 0.0594 mL | 0.2968 mL | 0.5935 mL | 1.4838 mL | |
| 10 mM | 0.0297 mL | 0.1484 mL | 0.2968 mL | 0.7419 mL | |
| 15 mM | 0.0198 mL | 0.0989 mL | 0.1978 mL | 0.4946 mL | |
| 20 mM | 0.0148 mL | 0.0742 mL | 0.1484 mL | 0.3709 mL | |
| 25 mM | 0.0119 mL | 0.0594 mL | 0.1187 mL | 0.2968 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
RVG-Cys Related Classifications
HY-P5623A Related Classifications
Powered by Bioz