RVG-Cys acetate
Based on 1 Customer Validation
RVG-Cys (RVG29-Cys) acetate is a peptide derived from rabies virus glycoprotein (RVG29) with Cys attached to facilitate subsequent conjugation. RVG-Cys acetate enhances the specific targeted delivery of proteins in brain tissue and neurons.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza : 99.72%
- Fòrmula: C144H222N44O44S3.xC2H4O2
- Peso molecular:3369.77 (free acid)
-
Almacenamiento:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Actividad biológica
Descripciòn
Chemical Information
-
Appearance Solid
-
Peso molecular 3369.77 (free acid)
-
Fòrmula C144H222N44O44S3.xC2H4O2
-
Color White to off-white
-
Synonyms
RVG29-Cys acetate; RDP-Cys acetate; Rabies Virus Glycoprotein-29-Cys acetate
-
Sequence
Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys
-
Sequence Shortening
YTIWMPENPRPGTPCDIFTNSRGKRASNGC
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvente y solubilidad
In Vitro:
H2O : ≥ 100 mg/mL
DMSO : 3.33 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Pureza y Documentación
-
Ficha de datos (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Kim JY, et al. Brain-targeted delivery of protein using chitosan- and RVG peptide-conjugated, pluronic-based nano-carrier. Biomaterials. 2013 Jan;34(4):1170-8. [Content Brief]
[2]. Li C, et al. miR-NPs-RVG promote spinal cord injury repair: implications from spinal cord-derived microvascular endothelial cells. J Nanobiotechnology. 2024 Sep 28;22(1):590. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)