1. Anti-infection
  2. RABV
  3. RVG-Cys

RVG-Cys  (Synonyms: RVG29-Cys; RDP-Cys; Rabies Virus Glycoprotein-29-Cys)

Cat. No.: HY-P5623A Purity: 99.95%
Handling Instructions Technical Support

RVG-Cys (RVG29-Cys) is a peptide derived from rabies virus glycoprotein (RVG29) with Cys attached to facilitate subsequent conjugation. RVG-Cys enhances the specific targeted delivery of proteins in brain tissue and neurons.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

RVG-Cys

RVG-Cys Chemical Structure

CAS No. : 1186105-01-0

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of RVG-Cys:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

RVG-Cys (RVG29-Cys) is a peptide derived from rabies virus glycoprotein (RVG29) with Cys attached to facilitate subsequent conjugation. RVG-Cys enhances the specific targeted delivery of proteins in brain tissue and neurons[1][2].

In Vivo

RVG29-Cys coupled to chitosan Pluronic-based nano-carriers (RVG29-cys incubated with MAL-PEG-NC for 48 hours) (5 mg/kg, i.v., once) enhances the brain-targeted delivery of active β-galactosidase in athymic nude mice and prolongs its accumulation time in the brain[1].
miR-NP-RVG (RVG29-cys incubated with miR-NPs for 48 hours) (2 mg/kg, i.v., 3 times for 7 days) promotes axonal regeneration and functional recovery in a rat spinal cord injury (SCI) model[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Athymic nude mice (6-week-old male mice)[1]
Dosage: 5 mg/kg RVG29-Cys coupled to chitosan Pluronic-based nano-carriers
Administration: Intravenous injection (i.v.), once
Result: Increased brain tissue β-galactosidase activity.
Prolonged the accumulation time in the brain.
Animal Model: Rat SCI model (Female Wistar rats, weighing 210 ± 10 g)[2]
Dosage: 2 mg/kg miR-NP-RVG
Administration: Intravenous injection (i.v.), 3 times for 7 days
Result: Down-regulated the expression of miR-323-5p in residual neurons.
Increased the density of nerve fibers.
Molecular Weight

3369.77

Formula

C144H222N44O44S3

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys

Sequence Shortening

YTIWMPENPRPGTPCDIFTNSRGKRASNGC

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : ≥ 100 mg/mL (29.68 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2968 mL 1.4838 mL 2.9676 mL
5 mM 0.0594 mL 0.2968 mL 0.5935 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.95%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2968 mL 1.4838 mL 2.9676 mL 7.4189 mL
5 mM 0.0594 mL 0.2968 mL 0.5935 mL 1.4838 mL
10 mM 0.0297 mL 0.1484 mL 0.2968 mL 0.7419 mL
15 mM 0.0198 mL 0.0989 mL 0.1978 mL 0.4946 mL
20 mM 0.0148 mL 0.0742 mL 0.1484 mL 0.3709 mL
25 mM 0.0119 mL 0.0594 mL 0.1187 mL 0.2968 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RVG-Cys
Cat. No.:
HY-P5623A
Quantity:
MCE Japan Authorized Agent: