CDK4 Protein, Human (sf9, His, Avi)
Based on 1 publication(s) in Google Scholar
CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G(1)/S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G(1) phase, releases E2F and promotes transcription of genes that drive G(1) progression. CDK4 Protein, Human (sf9, His, Avi) is the recombinant human-derived CDK4, expressed by Sf9 insect cells, with N-Avi, N-His labeled tag. The total length of CDK4 Protein, Human (sf9, His, Avi) is 303 a.a..
- Species: Human
- Source: Sf9 insect cells
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G(1)/S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G(1) phase, releases E2F and promotes transcription of genes that drive G(1) progression. CDK4 Protein, Human (sf9, His, Avi) is the recombinant human-derived CDK4, expressed by Sf9 insect cells, with N-Avi, N-His labeled tag. The total length of CDK4 Protein, Human (sf9, His, Avi) is 303 a.a..
CDK4 protein serves as the Ser/Thr-kinase component within cyclin D-CDK4 (DC) complexes, orchestrating the phosphorylation and inhibition of members belonging to the retinoblastoma (RB) protein family, including RB1. This regulatory activity is pivotal in controlling the cell cycle during the G(1)/S transition. The phosphorylation of RB1 instigates the dissociation of the transcription factor E2F from the RB/E2F complexes, facilitating the subsequent transcription of E2F target genes that drive progression through the G(1) phase. Particularly notable is the hypophosphorylation of RB1 occurring in early G(1) phase. As essential integrators of diverse mitogenic and antimitogenic signals, cyclin D-CDK4 complexes play a central role in cell cycle regulation. Additionally, CDK4 protein exhibits the capability to phosphorylate SMAD3 in a cell-cycle-dependent manner, thereby repressing its transcriptional activity. CDK4 is a crucial component of the ternary complex, cyclin D/CDK4/CDKN1B, which is indispensable for the nuclear translocation and activity of the cyclin D-CDK4 complex.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cancer Med
Artesunate Induces G0/G1 Phase Arrest in Tumor Cells and Associates With Cyclin-Dependent Kinase 4 (CDK4). [Abstract]2026 May;15(5):e71907. PMID: 42083272
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-Avi;N-His
-
Accession
P11802-1 (M1-E303)
-
Gene ID1019
-
Molecular Construction
-
N-term
-
His-Avi
-
CDK4 (M1-E303)
Accession # P11802 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CDK4; Cyclin-Dependent Kinase 4; Cyclin Dependent Kinase 4; Cyclin-Dependent Kinase; PSK-J3; MCPH31; Cell Division Protein Kinase 4; CMM3
-
AA Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
-
Predicted Molecular Mass
38.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
