1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. Cyclin-Dependent Kinases (CDKs) CDK
  5. Cyclin-Dependent Kinase 6 (CDK6)
  6. CDK6 Protein, Human (sf9, His-Avi)

The CDK6ic complex is an important serine/threonine protein kinase that regulates cell cycle progression and differentiation, promoting the G1/S transition by phosphorylating substrates such as pRB/RB1 and NPM1. It interacts with D-type G1 cyclins during interphase to form active pRB/RB1 kinase, which controls cell cycle entry. CDK6 Protein, Human (Sf9, His-Avi) is the recombinant human-derived CDK6, expressed by Sf9 insect cells, with N-His, N-Avi labeled tag. The total length of CDK6 Protein, Human (Sf9, His-Avi) is 326 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE CDK6 Protein, Human (sf9, His-Avi)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The CDK6ic complex is an important serine/threonine protein kinase that regulates cell cycle progression and differentiation, promoting the G1/S transition by phosphorylating substrates such as pRB/RB1 and NPM1. It interacts with D-type G1 cyclins during interphase to form active pRB/RB1 kinase, which controls cell cycle entry. CDK6 Protein, Human (Sf9, His-Avi) is the recombinant human-derived CDK6, expressed by Sf9 insect cells, with N-His, N-Avi labeled tag. The total length of CDK6 Protein, Human (Sf9, His-Avi) is 326 a.a..

Background

The CDK6ic complex, a serine/threonine-protein kinase, assumes a pivotal role in cell cycle regulation and differentiation, specifically promoting the G1/S transition. This complex exerts its regulatory influence by phosphorylating critical substrates such as pRB/RB1 and NPM1. During interphase, the CDK6 interacts with D-type G1 cyclins, forming an active pRB/RB1 kinase and governing entry into the cell cycle. Notably, this complex is intricately involved in both the initiation and maintenance of cell cycle exit during cellular differentiation, acting as a negative regulator of cell differentiation while remaining essential for the proliferation of specific cell types, including erythroid and hematopoietic cells. Its indispensable role extends to thymocyte development and the promotion of newborn neuron production. Furthermore, in astrocytes, the CDK6-CCND1 complex facilitates changes in gene expression patterns, modulates the actin cytoskeleton, and enhances motility during cell differentiation. Importantly, it exerts regulatory control over myeloid differentiation and delays senescence, highlighting its diverse and crucial functions in cellular processes. Additionally, the complex plays a role in promoting beta-cell proliferation in the pancreatic islets of Langerhans and may contribute to centrosome organization during various cell cycle phases.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-Avi

Accession

Q00534 (M1-A326)

Gene ID

1021

Protein Length

Full Length

Synonyms
Cyclin-dependent kinase 6; Cell division protein kinase 6; CDKN6; EC:2.7.11.22
AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Molecular Weight

41.3 KDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 1 mM DTT, 200 mM NaCl, 20% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CDK6 Protein, Human (sf9, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK6 Protein, Human (sf9, His-Avi)
Cat. No.:
HY-P702601
Quantity:
MCE Japan Authorized Agent: