CDK6 Protein, Human (sf9, His-Avi)
Based on 1 publication(s) in Google Scholar
The CDK6ic complex is an important serine/threonine protein kinase that regulates cell cycle progression and differentiation, promoting the G1/S transition by phosphorylating substrates such as pRB/RB1 and NPM1. It interacts with D-type G1 cyclins during interphase to form active pRB/RB1 kinase, which controls cell cycle entry. CDK6 Protein, Human (Sf9, His-Avi) is the recombinant human-derived CDK6, expressed by Sf9 insect cells, with N-His, N-Avi labeled tag. The total length of CDK6 Protein, Human (Sf9, His-Avi) is 326 a.a..
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The CDK6ic complex is an important serine/threonine protein kinase that regulates cell cycle progression and differentiation, promoting the G1/S transition by phosphorylating substrates such as pRB/RB1 and NPM1. It interacts with D-type G1 cyclins during interphase to form active pRB/RB1 kinase, which controls cell cycle entry. CDK6 Protein, Human (Sf9, His-Avi) is the recombinant human-derived CDK6, expressed by Sf9 insect cells, with N-His, N-Avi labeled tag. The total length of CDK6 Protein, Human (Sf9, His-Avi) is 326 a.a..
The CDK6ic complex, a serine/threonine-protein kinase, assumes a pivotal role in cell cycle regulation and differentiation, specifically promoting the G1/S transition. This complex exerts its regulatory influence by phosphorylating critical substrates such as pRB/RB1 and NPM1. During interphase, the CDK6 interacts with D-type G1 cyclins, forming an active pRB/RB1 kinase and governing entry into the cell cycle. Notably, this complex is intricately involved in both the initiation and maintenance of cell cycle exit during cellular differentiation, acting as a negative regulator of cell differentiation while remaining essential for the proliferation of specific cell types, including erythroid and hematopoietic cells. Its indispensable role extends to thymocyte development and the promotion of newborn neuron production. Furthermore, in astrocytes, the CDK6-CCND1 complex facilitates changes in gene expression patterns, modulates the actin cytoskeleton, and enhances motility during cell differentiation. Importantly, it exerts regulatory control over myeloid differentiation and delays senescence, highlighting its diverse and crucial functions in cellular processes. Additionally, the complex plays a role in promoting beta-cell proliferation in the pancreatic islets of Langerhans and may contribute to centrosome organization during various cell cycle phases.
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Med Chem
Imaging CDK4/6 Broaden Options of Breast Cancer Diagnostics with Positron Emission Tomography. [Abstract]2025 Feb 27;68(4):4635-4649. PMID: 39945599
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-Avi
-
Accession
Q00534 (M1-A326)
-
Gene ID1021
-
Protein Length
Full Length
-
Synonyms
CDK6; Cell Division Protein Kinase 6; Cyclin Dependent Kinase 6; Cyclin-Dependent Kinase 6; PLSTIRE; MCPH12; Serine/Threonine-Protein Kinase PLSTIRE; CDKN6
-
AA Sequence
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
-
Predicted Molecular Mass
41.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 1 mM DTT, 200 mM NaCl, 20% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)