1. Recombinant Proteins
  2. IL-17F Protein, Human

IL-17F Protein, Human

Cat. No.: HY-P7209
Handling Instructions

IL-17F Protein, Human has multiple functions in inflammatory responses and plays a protective role in some tumorigenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-17F; Cytokine ML-1
Species

Human

Source

E. coli

Accession

Q96PD4 (R31-Q163)

Gene ID

112744

Molecular Weight

Approximately 30.1 kDa

AA Sequence

MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Biological Activity
The ED50 is <20 ng/mL as measured by murine NIH/3T3 cells, corresponding to a specific activity of >5.0 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.2, with trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Interleukin-17F could induce pulmonary neutrophilia and amplifies antigen-induced allergic response[1]. IL-17F has been shown to have multiple functions in inflammatory responses and plays an important role in the tumorigenesis of human colonic epithelial cells.. Similar to IL-17A, IL-17F induces the production of many pro-inflammatory cytokines (IL-6/GM-CSF) and chemokines (CXCL1/2/5) in different cell types, as well as enhances granulopoiesis and neutrophil recruitment[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17F Protein, Human
Cat. No.:
HY-P7209
Quantity:
MCE Japan Authorized Agent: