1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. IL-17A Protein, Human

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Human is a recombinant human IL-17A protein and is expressed in E. coli. It consists of 137 amino acids (I19-A155).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    IL-17A Protein, Human purchased from MCE. Usage Cited in: FASEB J. 2025 Apr 15;39(7):e70539.  [Abstract]

    HACAT cells were treated with different concentrations of IL-17A (0, 25, 50, 100 ng/mL) for 24 h. Lysates were immunoblotted with indicated antibodies. Sample numbers, n = 3. The results showed that IL-17A protein induced δ-catenin expression in a concentration-dependent manner.

    IL-17A Protein, Human purchased from MCE. Usage Cited in: FASEB J. 2025 Apr 15;39(7):e70539.  [Abstract]

    HACATs that silenced δ-ctn were then treated with 100 ng/mL of IL-17A in 24 h. Cells were performed with CCK8 assay, and the cell proliferation rate was measured by the absorbance at OD 450 nm.

    IL-17A Protein, Human purchased from MCE. Usage Cited in: FASEB J. 2025 Apr 15;39(7):e70539.  [Abstract]

    Images of EDU staining by HACATs that silenced δ-ctn were then treated with 100 ng/mL of IL-17A in 24 h, and cells were co-stained with DAPI to visualize nuclei. Bar = 50 μm. Sample numbers, n = 3.

    IL-17A Protein, Human purchased from MCE. Usage Cited in: Clin Immunol. 2025 Apr 25:110494.  [Abstract]

    IL-17A protein (100 ng/mL; 15 min-24 h) significantly downregulated the expression level of IκBα protein in KRT1-knockdown HaCaT cells.

    IL-17A Protein, Human purchased from MCE. Usage Cited in: Clin Immunol. 2025 Apr 25:110494.  [Abstract]

    RT-qPCR analysis of IL-8 expression in KRT1 knockdown cells stimulated with IL-17A (100 ng/mL) at 3 h, 6 h, 24 h. The results showed that in KRT1-knockdown cells, the expression level of IL-8 protein was significantly upregulated after stimulation with IL-17A protein for 3 h, 6 h, and 24 h, respectively.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human is a recombinant human IL-17A protein and is expressed in E. coli. It consists of 137 amino acids (I19-A155).

    Background

    Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
    The human IL-17A shares 63.23% amino acid sequence identity with mouse and 61.90% identity with rat.
    IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
    IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

    In Vitro

    IL-17A (100 ng/mL; 24 h) inhibits the expression of thymic stromal lymphopoietin (TSLP) in human primary keratinocytes[5].
    IL-17A (0.1–100 ng/mL; 0-24 h) significantly potentiates TNF-α-induced IL-8 protein secretion and gene expression in a concentration- and time-dependent manner[6].

    Biological Activity

    1.Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells and the ED50 is 1-7 ng/mL.
    2.Measured by its ability to induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is ≤3.340 ng/mL. Corresponding to a specific activity is ≥2.99 × 105 U/mg.

    • Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 6.256 ng/mL, corresponding to a specific activity is 1.59×105 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    Q16552 (G24-A155)

    Gene ID
    Molecular Construction
    N-term
    IL-17A (G24-A155)
    Accession # Q16552
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuIL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
    AA Sequence

    GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

    Predicted Molecular Mass
    15.3 kDa
    Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 500 mM arginine, pH 8.0.
    3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IL-17A Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-17A Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-17A Protein, Human
    Cat. No.:
    HY-P7036
    Quantity:
    MCE Japan Authorized Agent: