1. Recombinant Proteins
  2. IL-17A Protein, Human

IL-17A Protein, Human

Cat. No.: HY-P7036
Handling Instructions

IL-17A Protein, Human is a proinflammatory cytokine.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $300 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
Species

Human

Source

E. coli

Accession

Q16552 (I19-A155)

Gene ID

3605

Molecular Weight

Approximately 15.3 kD

AA Sequence

IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Biological Activity
The ED50 is <10 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The interleukin-17 (IL-17) cytokines, IL-17A to IL-17F, are emerging as critical players in host defence responses and inflammatory diseases. The interleukin-17 (IL-17) cytokines are emerging as key players in immune responses. The first member to be identified, IL-17A, is originally cloned as cytotoxic T-lymphocyte antigen-8, a gene sharing homology with the HSV13 gene from herpesvirus Saimiri. The other members, IL-17B to IL-17F are subsequently identified based on their homology to IL-17A. These proteins are highly conserved at the C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Members of the IL-17 receptor family, IL-17RA to IL-17RE, mediate the biological functions of these cytokines. Accumulating evidence indicates that these interactions induce pro-inflammatory programmes[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17A Protein, Human
Cat. No.:
HY-P7036
Quantity:
MCE Japan Authorized Agent: