1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. OSM Protein, Human (His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    OSM Protein, Human (His) purchased from MCE. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148.  [Abstract]

    OSM (10-100 ng/mL; 1-5 Days). Quantitative assessment of BMSC proliferation capacity was performed via CCK-8 assay on days 1, 3, and 5.

    OSM Protein, Human (His) purchased from MCE. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148.  [Abstract]

    OSM (10–50 ng/mL; 200 μL applied dropwise onto the chicken chorioallantoic membrane (CAM) surface) significantly promoted angiogenesis. The 50 ng/mL OSM group exhibited 545.3 branch points, which were 2.6- and 1.5-fold higher than those in the control and 100 ng/mL OSM groups, respectively.

    OSM Protein, Human (His) purchased from MCE. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148.  [Abstract]

    OSM (50 ng/mL; 24 h) significantly promoted the vertical migration of BMSCs, with the number of migrated cells reaching 94 per field of view—1.3 times that of the control group, 1.1 times that of the 10 ng/mL OSM group, and 1.1 times that of the 100 ng/mL OSM group.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    Description

    OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

    Background

    OSM Protein stands as a versatile growth regulator with dual inhibitory effects on the proliferation of various tumor cell lines and stimulatory effects on AIDS-KS cell proliferation. Notably, OSM orchestrates the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. This multifaceted growth regulator engages both the type I OSM receptor, forming heterodimers composed of LIFR and IL6ST, and the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative and proliferative roles, OSM plays a crucial part in the maturation of fetal hepatocytes, contributing significantly to liver development and regeneration.

    Biological Activity

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1-1.0 ng/mL.

    • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2921 ng/mL, corresponding to a specific activity is 3.423×106 units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    N-6*His

    Accession

    P13725 (A26-R221)

    Gene ID
    Molecular Construction
    N-term
    6*His
    OSM (A26-R221)
    Accession # P13725
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Oncostatin-M; OSM
    AA Sequence

    AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

    Predicted Molecular Mass
    24.4 kDa
    Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, pH 7.5.
    2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM EDTA, 200 mM NaCl,4% Mannitol, pH 7.5.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation

    OSM Protein, Human (His) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    OSM Protein, Human (His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    OSM Protein, Human (His)
    Cat. No.:
    HY-P70465
    Quantity:
    MCE Japan Authorized Agent: