Copy Link Print Information

OSM Protein, Human (His)

6 Cited Publications
Customer Review

Based on 6 publication(s) in Google Scholar

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • OSM Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

Background

OSM Protein stands as a versatile growth regulator with dual inhibitory effects on the proliferation of various tumor cell lines and stimulatory effects on AIDS-KS cell proliferation. Notably, OSM orchestrates the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. This multifaceted growth regulator engages both the type I OSM receptor, forming heterodimers composed of LIFR and IL6ST, and the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative and proliferative roles, OSM plays a crucial part in the maturation of fetal hepatocytes, contributing significantly to liver development and regeneration.

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1-1.0 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P13725 (A26-R221)

  • Gene ID
    5008  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • OSM (A26-R221)
      Accession # P13725
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    OSM; Oncostatin-M; Oncostatin M; MGC20461

  • AA Sequence

    AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

  • Predicted Molecular Mass

    24.4 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM EDTA, 200 mM NaCl,4% Mannitol, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2921 ng/mL, corresponding to a specific activity is 3.423×106 units/mg.

  • 1/16

    OSM Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148. [Abstract]

    Customer Validation
     OSM (10-100 ng/mL; 1-5 Days). Quantitative assessment of BMSC proliferation capacity was performed via CCK-8 assay on days 1, 3, and 5.

  • 1/16

    OSM Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148. [Abstract]

    Customer Validation
     OSM (10–50 ng/mL; 200 μL applied dropwise onto the chicken chorioallantoic membrane (CAM) surface) significantly promoted angiogenesis. The 50 ng/mL OSM group exhibited 545.3 branch points, which were 2.6- and 1.5-fold higher than those in the control and 100 ng/mL OSM groups, respectively.

  • 1/16

    OSM Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148. [Abstract]

    Customer Validation
     OSM (50 ng/mL; 24 h) significantly promoted the vertical migration of BMSCs, with the number of migrated cells reaching 94 per field of view—1.3 times that of the control group, 1.1 times that of the 10 ng/mL OSM group, and 1.1 times that of the 100 ng/mL OSM group.

  • OSM Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • Experimental Validation Results for OSM Protein, Human (His)
  • OSM Protein, Human (His) Product Image

  • OSM Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148. [Abstract]

    OSM (10-100 ng/mL; 1-5 Days). Quantitative assessment of BMSC proliferation capacity was performed via CCK-8 assay on days 1, 3, and 5.

  • OSM Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148. [Abstract]

    OSM (10–50 ng/mL; 200 μL applied dropwise onto the chicken chorioallantoic membrane (CAM) surface) significantly promoted angiogenesis. The 50 ng/mL OSM group exhibited 545.3 branch points, which were 2.6- and 1.5-fold higher than those in the control and 100 ng/mL OSM groups, respectively.

  • OSM Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Orthop Translat. 2025 Jun 20:53:138-148. [Abstract]

    OSM (50 ng/mL; 24 h) significantly promoted the vertical migration of BMSCs, with the number of migrated cells reaching 94 per field of view—1.3 times that of the control group, 1.1 times that of the 10 ng/mL OSM group, and 1.1 times that of the 100 ng/mL OSM group.