1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 alpha
  6. IL-1 alpha Protein, Human

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways. IL-1 alpha protein, Human is a recombinant protein consisting of 159 amino acids (S113-A271) and is produced by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    IL-1 alpha Protein, Human purchased from MCE. Usage Cited in: Int J Biol Macromol. 2025 Aug 21;323(Pt 1):147047.  [Abstract]

    Western blot analysis showing the protein expression levels of Bcl-2 and Bax in HDF cells . CK: cytokine cocktail containing IL-1α (HY-P7027, IL-1 alpha Protein, Human) (10 ng/mL; 24 h) and IL-4.

    IL-1 alpha Protein, Human purchased from MCE. Usage Cited in: Oncol Rep. 2023 Aug;50(2):148.  [Abstract]

    Flow cytometric analysis in the Annexin V-FITC/PI apoptosis assay to determine the ratio of apoptotic PANC-1 cells following ST2825 treatment combined with IL-1α (HY-P7027, IL-1 alpha Protein, Human) (10 ng/mL; 24 h). The results demonstrated that IL‑1α pretreatment for 24 h significantly reversed ST2825‑induced apoptosis.

    IL-1 alpha Protein, Human purchased from MCE. Usage Cited in: Oncol Rep. 2023 Aug;50(2):148.  [Abstract]

    IHC analysis of phosphorylated-p65 expression in the tumors of the groups in negative control, ST2825 (ST), ST after IL-1α (HY-P7027, IL-1 alpha Protein, Human) (10 ng/mL; 1 week) and ST + AKT1). The results showed that the level of phosphorylated p65 decreased in the ST2825 group relative to the negative control group. This reduction was partially reversed in ST2825-treated cells with IL‑1α pretreatment, whereas no such reversal was observed in the ST2825 + AKT1 group.

    IL-1 alpha Protein, Human purchased from MCE. Usage Cited in: Oncol Rep. 2023 Aug;50(2):148.  [Abstract]

    Image of each nude mouse and its hypodermic tumor in four groups (the mice treated with negative control, ST2825, ST after IL-1α (HY-P7027, IL-1 alpha Protein, Human) (10 ng/mL; 1 week) and ST + AKT1).

    IL-1 alpha Protein, Human purchased from MCE. Usage Cited in: Oncol Rep. 2023 Aug;50(2):148.  [Abstract]

    Western blot analysis of NC and IL-1α (HY-P7027, IL-1 alpha Protein, Human)‑treated (10 ng/mL for 1 week) cells. The results of western blot analysis demonstrated that IL-1α increased the level of phosphorylated p65 and phosphorylated akt1, and reduced the expression of p21. NC, negative control.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][4]. IL-1 alpha protein, Human is a recombinant protein consisting of 159 amino acids (S113-A271) and is produced by E. coli.

    Background

    IL-1 alpha (interleukin-1 alpha) is a major agonist of IL-1. IL-1α is present in all mesenchymal cells in particular, cells rich in IL-1α constitute tissues with a barrier function, such as keratinocytes in the skin, type 2 epithelial cells in the lung, the epithelium of the entire gastrointestinal tract, endothelial cells in blood vessels, and astrocytes in the brain[1]. The precursor of IL-1α (ProIL-1α) is processed by the Ca2+-dependent protease calpain (including caspase-1) into the mature 17 kDa form and the 16 kDa N-terminal cleavage product – the propiece of IL-1α, also termed IL-1α N-terminal peptide (IL-1NTP). The latent form of calpain is activated in cells under inflammatory conditions and especially upon loss of plasma membrane integrity, which occurs during necrosis. pro-IL-1α and mature IL-1α bind to IL-1R and induces the secretion of IL-6 and TNF[5]. IL-1α acts as an ‘alarmin’ and as a primum movens of tissue inflammation[1]. IL-1 alpha trigger inflammation in a pathway initiated through Myd88 activation and culminated in NF-κB–induced transcription of inflammatory genes[2]. IL-1 alpha inhibits differentiation of preadipocytes and lipid accumulation[3]. IL-1 alpha induces apoptosis and inhibits the osteoblast differentiation[4].

    In Vitro

    IL-1 alpha (0.5, 1, 2.5, 5, 10 ng/mL; 5 days) significantly reduces the cell viability in MC3T3-E1 cells[4].
    IL-1 alpha (0.5, 1, 2.5, 5, 10 ng/mL 24 h) decreases the ALP and caspase-3 activity in MC3T3-E1 cells, increases the expression of Bax and caspase-3 mRNA and protein level in a dose-dependent manner, decreases the mRNA expression and the protein levels of Runx2, ALP, OSX and OCN; induces apoptosis[4].

    In Vivo

    IL-1 alpha (10 µg/kg; i.p.) significantly increases the TG (triglyceride) level at 12 h in serum in C57BL/6J male mice[3].
    IL-1 alpha (1, 10, 100 ng/mL; 8 days) inhibits differentiation of preadipocytes and lipid accumulation in a dose-dependent manner in 3T3-L1 cells[3].

    Biological Activity

    1.The ED50 is <1.0 pg/mL as measured by murine D10S cells, corresponding to a specific activity of >1.0 × 109 units/mg.
    2.Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is ≤5.562 pg/mL, corresponding to a specific activity is ≥1.79× 108 units/mg.
    3.Measured in a cell proliferation assay using CTLL-2 cells. The ED50 for this effect is 10.95 pg/mL, corresponding to a specific activity is 91.32×106 units/mg.
    4.Measured by its ability to down regulate the expression of CCN2 in NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <30 pg/mL.

    • Measured in a cell proliferation assay using CTLL-2 cells. The ED50 for this effect is 10.95 pg/mL, corresponding to a specific activity is 91.32×106 units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P01583 (S113-A271)

    Gene ID
    Molecular Construction
    N-term
    IL-1α (S113-A271)
    Accession # P01583
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuIL-1α; Hematopoietin-1; IL1A; IL1F1; IL-1 alpha
    AA Sequence

    SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

    Predicted Molecular Mass
    18 kDa
    Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
    4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-1 alpha Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-1 alpha Protein, Human
    Cat. No.:
    HY-P7027
    Quantity:
    MCE Japan Authorized Agent: