1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 alpha
  6. IL-1 alpha Protein, Rat

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways. IL-1 alpha protein, Rat is a recombinant protein consisting of 156 amino acids (S115-S270) and is produced by E. coli.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
10 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][4]. IL-1 alpha protein, Rat is a recombinant protein consisting of 156 amino acids (S115-S270) and is produced by E. coli.

Background

IL-1 alpha (interleukin-1 alpha) is a major agonist of IL-1. IL-1α is present in all mesenchymal cells in particular, cells rich in IL-1α constitute tissues with a barrier function, such as keratinocytes in the skin, type 2 epithelial cells in the lung, the epithelium of the entire gastrointestinal tract, endothelial cells in blood vessels, and astrocytes in the brain[1].
The precursor of IL-1α (ProIL-1α) is processed by the Ca2+-dependent protease calpain (including caspase-1) into the mature 17 kDa form and the 16 kDa N-terminal cleavage product – the propiece of IL-1α, also termed IL-1α N-terminal peptide (IL-1NTP). The latent form of calpain is activated in cells under inflammatory conditions and especially upon loss of plasma membrane integrity, which occurs during necrosis. pro-IL-1α and mature IL-1α bind to IL-1R and induces the secretion of IL-6 and TNF[5].
IL-1α acts as an ‘alarmin’ and as a primum movens of tissue inflammation[1]. IL-1 alpha inhibits differentiation of preadipocytes and lipid accumulation[2]. IL-1 alpha induces apoptosis and inhibits the osteoblast differentiation[3]. IL-1 alpha trigger inflammation in a pathway initiated through Myd88 activation and culminated in NF-κB–induced transcription of inflammatory genes[4].

In Vitro

IL-1 alpha (0.5, 1, 2.5, 5, 10 ng/ml; 5 days) significantly reduces the cell viability in MC3T3-E1 cells[3].

In Vivo

IL-1 alpha (10 µg/kg; i.p.) significantly increases the TG (triglyceride) level at 12 h in serum in C57BL/6J male mice[2].

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P16598 (S115-S270)

Gene ID
Molecular Construction
N-term
IL-1α (S115-S270)
Accession # P16598
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-1 alpha; IL-1 alpha; Il1a
AA Sequence

SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Predicted Molecular Mass
17.9 kDa
Masse moléculaire

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Pureté

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation
Références
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

IL-1 alpha Protein, Rat

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
IL-1 alpha Protein, Rat
Cat. No.:
HY-P72572
Quantité:
MCE Japan Authorized Agent: