Copy Link Print Information

IL-22 Protein, Human

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • IL-22 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.

Background

Interleukin-22 (IL-10-related T cell-derived inducible factor/IL-TIF/IL-22) is a novel cytokine belonging to the IL-10 family. Recombinant humanIL-22 (hIL-22) is found to activate the signal transducers and activators of transcription factors 1 and 3 as well as acute phase reactants in several hepatoma cell lines, suggesting its involvement in the inflammatory response. IL-22 is a member of interleukin-10 family of cytokines, which also includes IL-19, IL-20, and IL-24 in addition to IL-10 and a number of its viral homologs[1].

Verified Bioactivity

Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The EDsub>50 for this effect is <1 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9GZX6 (A34-I179)

  • Gene ID
    50616  [NCBI]
  • Molecular Construction
    • N-term
    • IL-22 (A34-I179)
      Accession # Q9GZX6
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL22; TIFa; Interleukin 22; IL-10-Related T-Cell-Derived Inducible Factor; IL-TIF; Cytokine Zcyto18; ILTIF; Interleukin-22; IL-22; MGC79382; TIFIL-23; MGC79384; Zcyto18; IL-10-Related T-Cell-Derived-Inducible Factor; IL-D110; Interferon 2B1; IL-21; ZCYTO1

  • AA Sequence

    APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Nagem RA, et al. Crystal structure of recombinant human interleukin-22. Structure. 2002 Aug;10(8):1051-62. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The EDsub>50 for this effect is 152.2 pg/mL.corresponding to a specific activity is 6.57×106 U/mg.

  • 1/16

    IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Customer Validation
     Cell viability was assessed via the CCK-8 assay. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. CCK-8 results indicated that cell viability was markedly reduced in the M5 group compared with the control HEK group (p < 0.01).

  • 1/16

    IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Customer Validation
     Western blot to determine cell NLRP3, ASC, cleaved caspase-1, and GSDMD and GSDMD-N levels. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. The Western blot results showed that cellular protein levels of GSDMD-N, NLRP3, cleaved caspase-1, ASC and GSDMD were markedly elevated in the M5 group compared with the HEK group (p<0.01).

  • 1/16

    IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Customer Validation
     ELISA kits to assess IL-1β and IL-18 levels in the supernatants of cell culture medium. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. ELISA results revealed that the levels of IL-1β and IL-18 in cell supernatants were significantly elevated in the M5 group relative to the HEK group.

  • 1/16

    IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Customer Validation
     Measurement of cell LDH release using a reagent kit. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL‑22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. The results showed that lactate dehydrogenase (LDH) release in the M5-induced group was significantly higher than that in the HEK control group (p < 0.01).

  • 1/16

    IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: AMB Express. 2025 Aug 18;15(1):121. [Abstract]

    Customer Validation
     The effect of 5, 10 and 50 ng/mL IL-22 (12 h) (HY-P7039, IL-22 Protein, Human) on the proliferation of HaCaT cells was detected by CCK8 assay.

  • IL-22 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • Experimental Validation Results for IL-22 Protein, Human
  • IL-22 Protein, Human Product Image

  • IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Cell viability was assessed via the CCK-8 assay. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. CCK-8 results indicated that cell viability was markedly reduced in the M5 group compared with the control HEK group (p < 0.01).

  • IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Western blot to determine cell NLRP3, ASC, cleaved caspase-1, and GSDMD and GSDMD-N levels. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. The Western blot results showed that cellular protein levels of GSDMD-N, NLRP3, cleaved caspase-1, ASC and GSDMD were markedly elevated in the M5 group compared with the HEK group (p<0.01).

  • IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    ELISA kits to assess IL-1β and IL-18 levels in the supernatants of cell culture medium. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. ELISA results revealed that the levels of IL-1β and IL-18 in cell supernatants were significantly elevated in the M5 group relative to the HEK group.

  • IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]

    Measurement of cell LDH release using a reagent kit. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL‑22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. The results showed that lactate dehydrogenase (LDH) release in the M5-induced group was significantly higher than that in the HEK control group (p < 0.01).

  • IL-22 Protein, Human purchased from MedChemExpress. Usage Cited in: AMB Express. 2025 Aug 18;15(1):121. [Abstract]

    The effect of 5, 10 and 50 ng/mL IL-22 (12 h) (HY-P7039, IL-22 Protein, Human) on the proliferation of HaCaT cells was detected by CCK8 assay.