IL-22 Protein, Human

Cat. No.: HY-P7039: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Stock	Quantity
Free Sample	Apply now
2 μg	In-stock	Estimated Time of Arrival: December 31
10 μg	In-stock	Estimated Time of Arrival: December 31
50 μg	In-stock	Estimated Time of Arrival: December 31
100 μg	In-stock	Estimated Time of Arrival: December 31
500 μg	In-stock	Estimated Time of Arrival: December 31
1 mg	In-stock	Estimated Time of Arrival: December 31
> 1 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

3 Publications Citing Use of MCE IL-22 Protein, Human

Cell Proliferation/Viability Assay

ELISA

: IL-22 Protein, Human purchased from MCE. Usage Cited in: AMB Express. 2025 Aug 18;15(1):121. [Abstract]; The effect of 5, 10 and 50 ng/mL IL-22 (12 h) (HY-P7039, IL-22 Protein, Human) on the proliferation of HaCaT cells was detected by CCK8 assay.

: IL-22 Protein, Human purchased from MCE. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]; Cell viability was assessed via the CCK-8 assay. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. CCK-8 results indicated that cell viability was markedly reduced in the M5 group compared with the control HEK group (p < 0.01).

: IL-22 Protein, Human purchased from MCE. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]; Western blot to determine cell NLRP3, ASC, cleaved caspase-1, and GSDMD and GSDMD-N levels. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. The Western blot results showed that cellular protein levels of GSDMD-N, NLRP3, cleaved caspase-1, ASC and GSDMD were markedly elevated in the M5 group compared with the HEK group (p<0.01).

: IL-22 Protein, Human purchased from MCE. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]; ELISA kits to assess IL-1β and IL-18 levels in the supernatants of cell culture medium. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL-22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. ELISA results revealed that the levels of IL-1β and IL-18 in cell supernatants were significantly elevated in the M5 group relative to the HEK group.

: IL-22 Protein, Human purchased from MCE. Usage Cited in: Naunyn Schmiedebergs Arch Pharmacol. 2025 Apr;398(4):3843-3859. [Abstract]; Measurement of cell LDH release using a reagent kit. To explore the molecular mechanism by which BBR regulates psoriatic skin inflammation, human epidermal keratinocytes (HEKs) were cultured in vitro and stimulated with M5 (IL-17A, IL-22 (HY-P7039, human IL‑22 protein), IL-1α, OSM and TNF-α) (each cytokine at 10 ng/mL; 24 h) to mimic the immune microenvironment of psoriasis. The results showed that lactate dehydrogenase (LDH) release in the M5-induced group was significantly higher than that in the HEK control group (p < 0.01).

Biological Activity
Technical Parameters
Properties
Documentation
References

Description	IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.
Background	Interleukin-22 (IL-10-related T cell-derived inducible factor/IL-TIF/IL-22) is a novel cytokine belonging to the IL-10 family. Recombinant humanIL-22 (hIL-22) is found to activate the signal transducers and activators of transcription factors 1 and 3 as well as acute phase reactants in several hepatoma cell lines, suggesting its involvement in the inflammatory response. IL-22 is a member of interleukin-10 family of cytokines, which also includes IL-19, IL-20, and IL-24 in addition to IL-10 and a number of its viral homologs^[1].
Biological Activity	Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The EDsub>50 for this effect is <1 ng/mL. Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The EDsub>50 for this effect is 152.2 pg/mL.corresponding to a specific activity is 6.57×10⁶ U/mg.
Species	Human
Source	E. coli
Tag	Tag Free
Accession	Q9GZX6 (A34-I179)
Gene ID	50616 [NCBI]
Molecular Construction	N-term IL-22 (A34-I179) Accession # Q9GZX6 C-term
Protein Length	Full Length of Mature Protein
Synonyms	rHuIL-22; Cytokine Zcyto 18; IL-TIF
AA Sequence	APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Predicted Molecular Mass	16.9 kDa
Molecular Weight	Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
Purity	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Endotoxin Level	<0.2 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (260 KB) SDS (252 KB) COA (220 KB) Handling Instructions (2659 KB)
References	[1]. Nagem RA, et al. Crystal structure of recombinant human interleukin-22. Structure. 2002 Aug;10(8):1051-62. [Content Brief]

IL-22 Protein, Human Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Reconstitution Calculator
Dilution Calculator
Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)	=	Mass (in vial)	÷	Desired Reconstitution Concentration
	=		÷

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Specific Activity (Unit/mg)	=	10⁶	÷	Biological Activity (ED₅₀)
Unit/mg	=	10⁶	÷	ng/mL

Your Recently Viewed Products:

IL-22 Protein, Human

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Country or Region *

Email Address *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

IL-22 Protein, Human

3 Publications Citing Use of MCE IL-22 Protein, Human

Biological Activity

Technical Parameters

Properties

Documentation

References

IL-22 Protein, Human Related Classifications

Reconstitution Calculator

Dilution Calculator

Specific Activity Calculator

The reconstitution calculator equation

The dilution calculator equation

The specific activity calculator equation

Your Recently Viewed Products:

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report