IL-22 Protein, Human

IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.

Interleukin-22 (IL-10-related T cell-derived inducible factor/IL-TIF/IL-22) is a novel cytokine belonging to the IL-10 family. Recombinant humanIL-22 (hIL-22) is found to activate the signal transducers and activators of transcription factors 1 and 3 as well as acute phase reactants in several hepatoma cell lines, suggesting its involvement in the inflammatory response. IL-22 is a member of interleukin-10 family of cytokines, which also includes IL-19, IL-20, and IL-24 in addition to IL-10 and a number of its viral homologs^[1].

Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The EDsub>50 for this effect is <1 ng/mL.

• 
  Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The EDsub>50 for this effect is 152.2 pg/mL.corresponding to a specific activity is 6.57×10⁶ U/mg.

Human

E. coli

Tag Free

Q9GZX6 (A34-I179)

50616  [NCBI]

Full Length of Mature Protein

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Nagem RA, et al. Crystal structure of recombinant human interleukin-22. Structure. 2002 Aug;10(8):1051-62.  [Content Brief]