1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 alpha
  6. IL-1 alpha Protein, Human (Biotinylated, HEK293, Avi)

IL-1 alpha Protein, Human (Biotinylated, HEK293, Avi)

Cat. No.: HY-P72380
Handling Instructions Technical Support

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways. IL-1 alpha protein, Human (Biotinylated, HEK293, Avi) is a biotinylated recombinant protein with Avi label that consists of 159 amino acids (S113-A271) and is produced by E. coli.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][2]. IL-1 alpha protein, Human (Biotinylated, HEK293, Avi) is a biotinylated recombinant protein with Avi label that consists of 159 amino acids (S113-A271) and is produced by E. coli.

Background

IL-1 alpha (interleukin-1 alpha) is a major agonist of IL-1. IL-1α is present in all mesenchymal cells in particular, cells rich in IL-1α constitute tissues with a barrier function, such as keratinocytes in the skin, type 2 epithelial cells in the lung, the epithelium of the entire gastrointestinal tract, endothelial cells in blood vessels, and astrocytes in the brain[1]. The precursor of IL-1α (ProIL-1α) is processed by the Ca2+-dependent protease calpain (including caspase-1) into the mature 17 kDa form and the 16 kDa N-terminal cleavage product – the propiece of IL-1α, also termed IL-1α N-terminal peptide (IL-1NTP). The latent form of calpain is activated in cells under inflammatory conditions and especially upon loss of plasma membrane integrity, which occurs during necrosis. pro-IL-1α and mature IL-1α bind to IL-1R and induces the secretion of IL-6 and TNF[5]. IL-1α acts as an ‘alarmin’ and as a primum movens of tissue inflammation[1]. IL-1 alpha trigger inflammation in a pathway initiated through Myd88 activation and culminated in NF-κB–induced transcription of inflammatory genes[2]. IL-1 alpha inhibits differentiation of preadipocytes and lipid accumulation[3]. IL-1 alpha induces apoptosis and inhibits the osteoblast differentiation[4].

In Vitro

IL-1 alpha (0.5, 1, 2.5, 5, 10 ng/mL; 5 days) significantly reduces the cell viability in MC3T3-E1 cells[4].
IL-1 alpha (0.5, 1, 2.5, 5, 10 ng/mL 24 h) decreases the ALP and caspase-3 activity in MC3T3-E1 cells, increases the expression of Bax and caspase-3 mRNA and protein level in a dose-dependent manner, decreases the mRNA expression and the protein levels of Runx2, ALP, OSX and OCN; induces apoptosis[4].

In Vivo

IL-1 alpha (10 µg/kg; i.p.) significantly increases the TG (triglyceride) level at 12 h in serum in C57BL/6J male mice[3].
IL-1 alpha (1, 10, 100 ng/mL; 8 days) inhibits differentiation of preadipocytes and lipid accumulation in a dose-dependent manner in 3T3-L1 cells[3].

Species

Human

Source

E. coli

Tag

C-Avi

Accession

P01583 (S113-A271)

Gene ID
Molecular Construction
N-term
IL-1α (S113-A271)
Accession # P01583
Avi
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
Interleukin-1 Alpha; IL-1 Alpha; Hematopoietin-1; IL1A; IL1F1; IL-1a
AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Predicted Molecular Mass
20 kDa
분자량

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-1 alpha Protein, Human (Biotinylated, HEK293, Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-1 alpha Protein, Human (Biotinylated, HEK293, Avi)
Cat. No.:
HY-P72380
수량:
MCE Japan Authorized Agent: