OSM Protein, Mouse

OSM Protein, Mouse is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Oncostatin M is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix^[1].

The ED₅₀ is <10 ng/mL as measured by Rat Embryo Brain cells, corresponding to a specific activity of >1.0 × 10⁵ units/mg.

Mouse

E. coli

Tag Free

P53347 (N25-R205)

18413  [NCBI]

Partial

NRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR

Approximately 20.5 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.  [Content Brief]