Copy Link Print Information

OSM Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (HEK293, His) is the recombinant human-derived OSM protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • OSM Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (HEK293, His) is the recombinant human-derived OSM protein, expressed by HEK293 , with C-His labeled tag.

Background

OSM Protein stands as a versatile growth regulator with dual inhibitory effects on the proliferation of various tumor cell lines and stimulatory effects on AIDS-KS cell proliferation. Notably, OSM orchestrates the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. This multifaceted growth regulator engages both the type I OSM receptor, forming heterodimers composed of LIFR and IL6ST, and the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative and proliferative roles, OSM plays a crucial part in the maturation of fetal hepatocytes, contributing significantly to liver development and regeneration.

Verified Bioactivity

1.Human LIFR, hFc Tag captured on CM5 Chip via Protein A can bind Human OSM, His Tag with an affinity constant of 0.884 μM as determined in SPR assay. (Biacore T200)
2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells.The ED50 for this effect is 0.62 ng/mL.
3.Human OSM captured on CM5 Chip can bind Human LIFR, His Tag (HY-P77059) with an affinity constant of 0.226 μM as determined in SPR assay. (Biacore 8K).

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession

    P13725 (A26-R221)

  • Gene ID
    5008  [NCBI]
  • Molecular Construction
    • N-term
    • OSM (A26-R221)
      Accession # P13725
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    OSM; Oncostatin-M; Oncostatin M; MGC20461

  • AA Sequence

    AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

  • Predicted Molecular Mass

    23.2 kDa

  • Molecular Weight

    Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • OSM Protein, Human (HEK293, His) Product Image
    1/16
  • OSM Protein, Human (HEK293, His) Product Image