IL-17A Protein, Rhesus macaque (sf9)

Customer Review

Based on 1 Customer Validation

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Rhesus macaque (sf9) is a recombinant rhesus macaque IL-17A protein and is expressed in sf9 insect cells.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rhesus macaque (sf9) is a recombinant rhesus macaque IL-17A protein and is expressed in sf9 insect cells.

Background

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The rhesus macaque IL-17A shares 96.77% amino acid sequence identity with human and 63.23% identity with mouse.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

In Vitro

Rhesus macaque IL-17A (rhIL-17A) (1 ng/mL; 15-6 min) induces NF-κB phosphorylation and antibacterial protein expression in human Caco-2 cells[5].
Rhesus macaque IL-17A (1 ng/mL; 24 h) induces tight junction associated genes expression by human Caco-2 cells, and induces IL-6 expression by THP-1 cells[5].
Rhesus macaque IL-17A (1 ng/mL; 2 min) increases AP firing in small DRG neurons from the female rhesus macaque but fails to do so in DRG neurons of the male rhesus macaque[6].

Verified Bioactivity

Immobilized rhesus IL17a at 10μg/mL (100μL/well) can bind rhesus IL17RA-Fc ,the EC50 of rhesus IL17RA-Fc is 0.05-1 μg/mL.

Technical Parameters

  • Species Rhesus Macaque
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-17A (L24-A155)
      Accession # F6T3G5/XP_001106391.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

  • Predicted Molecular Mass

    15.1 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, pH 8.0, 10% glycerol, 150 mM NaCl.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00