IL-17A Protein, Rhesus macaque (sf9)
Based on 1 Customer Validation
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Rhesus macaque (sf9) is a recombinant rhesus macaque IL-17A protein and is expressed in sf9 insect cells.
- Species: Rhesus Macaque
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rhesus macaque (sf9) is a recombinant rhesus macaque IL-17A protein and is expressed in sf9 insect cells.
Background
Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The rhesus macaque IL-17A shares 96.77% amino acid sequence identity with human and 63.23% identity with mouse.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].
In Vitro
Rhesus macaque IL-17A (rhIL-17A) (1 ng/mL; 15-6 min) induces NF-κB phosphorylation and antibacterial protein expression in human Caco-2 cells[5].
Rhesus macaque IL-17A (1 ng/mL; 24 h) induces tight junction associated genes expression by human Caco-2 cells, and induces IL-6 expression by THP-1 cells[5].
Rhesus macaque IL-17A (1 ng/mL; 2 min) increases AP firing in small DRG neurons from the female rhesus macaque but fails to do so in DRG neurons of the male rhesus macaque[6].
Verified Bioactivity
Immobilized rhesus IL17a at 10μg/mL (100μL/well) can bind rhesus IL17RA-Fc ,the EC50 of rhesus IL17RA-Fc is 0.05-1 μg/mL.
Technical Parameters
-
Species Rhesus Macaque
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
F6T3G5/XP_001106391.1 (G24-A155)
-
Molecular Construction
-
N-term
-
IL-17A (L24-A155)
Accession # F6T3G5/XP_001106391.1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc
-
AA Sequence
GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
-
Predicted Molecular Mass
15.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, pH 8.0, 10% glycerol, 150 mM NaCl.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14. [Content Brief]
[2]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79. [Content Brief]
[3]. Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10(7):479-89. [Content Brief]
[4]. Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181(4):2799-805. [Content Brief]
[5]. Cui YF, et al. Molecular cloning, expression and biological activity of rhesus macaque interleukin-17A and interleukin-17F. Mol Immunol. 2019 Oct;114:196-206. [Content Brief]
[6]. Luo X, et al. IL-23/IL-17A/TRPV1 axis produces mechanical pain via macrophage-sensory neuron crosstalk in female mice. Neuron. 2021 Sep 1;109(17):2691-2706.e5. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
