1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. IL-17A Protein, Rhesus macaque (sf9)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Rhesus macaque (sf9) is a recombinant rhesus macaque IL-17A protein and is expressed in sf9 insect cells.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rhesus macaque (sf9) is a recombinant rhesus macaque IL-17A protein and is expressed in sf9 insect cells.

Background

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The rhesus macaque IL-17A shares 96.77% amino acid sequence identity with human and 63.23% identity with mouse.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

In Vitro

Rhesus macaque IL-17A (rhIL-17A) (1 ng/mL; 15-6 min) induces NF-κB phosphorylation and antibacterial protein expression in human Caco-2 cells[5].
Rhesus macaque IL-17A (1 ng/mL; 24 h) induces tight junction associated genes expression by human Caco-2 cells, and induces IL-6 expression by THP-1 cells[5].
Rhesus macaque IL-17A (1 ng/mL; 2 min) increases AP firing in small DRG neurons from the female rhesus macaque but fails to do so in DRG neurons of the male rhesus macaque[6].

Actividad biológica

Immobilized rhesus IL17a at 10μg/mL (100μL/well) can bind rhesus IL17RA-Fc ,the EC50 of rhesus IL17RA-Fc is 0.05-1 μg/mL.

Species

Rhesus Macaque

Source

Sf9 insect cells

Tag

Tag Free

Accession

F6T3G5/XP_001106391.1 (G24-A155)

Gene ID
Molecular Construction
N-term
IL-17A (L24-A155)
Accession # F6T3G5/XP_001106391.1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CTLA8; CTLA-8; IL-17; Interleukin-17A; IL17A
AA Sequence

GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Predicted Molecular Mass
15.1 kDa
Peso molecular

/

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, pH 8.0, 10% glycerol, 150 mM NaCl.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Referencias

IL-17A Protein, Rhesus macaque (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-17A Protein, Rhesus macaque (sf9)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-17A Protein, Rhesus macaque (sf9)
Cat. No.:
HY-P73177
Cantidad:
MCE Japan Authorized Agent: