1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-4 IL-17
  5. IL-17A
  6. IL-17A Protein, Cynomolgus (HEK293, His)

IL-17A Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P72772
Handling Instructions
Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Cynomolgus

Source

HEK 293

Tag

C-6His

Accession

XP_005552816 (G24­A155)

Gene ID

102119976

Synonyms
Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
AA Sequence

GIAIPRNSGCPNSEDKNFPRTVMVNLNIHNRNTSTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVKADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Molecular Weight

15-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Immobilized IL-17A Protein, Cynomolgus (HEK 293, His) at 10 μg/mL (100 μL/well) can bind Anti-Human IL-17A mAb. The ED50 of Anti-Human IL-17A mAb is 128 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17A Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72772
Quantity:
MCE Japan Authorized Agent: