IL-17A Protein, Rabbit (sf9, His)
Based on 1 Customer Validation
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Rabbit (sf9, His) is a recombinant rabbit IL-17A protein with His tag at the N-terminus and is expressed in sf9 insect cells. It consists of 130 amino acids (G24-A153).
- Species: Rabbit
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rabbit (sf9, His) is a recombinant rabbit IL-17A protein with His tag at the N-terminus and is expressed in sf9 insect cells. It consists of 130 amino acids (G24-A153).
Background
Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The rhesus macaque IL-17A shares 76.47% amino acid sequence identity with human and 68.63% identity with mouse.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized IL-17A Protein, Rabbit (sf9, His) at 10μg/mL (100μL/well) can bind rat IL17RA-Fc3 and the EC50 is 1-40 ng/mL.
Technical Parameters
-
Species Rabbit
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
G1SLF2 (G24-A153)
-
Molecular Construction
-
N-term
-
His
-
IL-17A (G24-A153)
Accession # G1SLF2 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc
-
AA Sequence
GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA
-
Predicted Molecular Mass
17.3 kDa
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PBS, 500 mM NaCl, 10 % glycerol, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14. [Content Brief]
[2]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79. [Content Brief]
[3]. Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10(7):479-89. [Content Brief]
[4]. Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181(4):2799-805. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)