2. Others Neuronal Signaling Membrane Transporter/Ion Channel Apoptosis
  3. Insecticide Calcium Channel Apoptosis Necroptosis
  4. ω-Hexatoxin-Hv1a

ω-Hexatoxin-Hv1a  (Synonyms: ω-ACTX-Hv1; ω-Atracotoxin-HV1)

Cat. No.: HY-P5142
Handling Instructions Technical Support

ω-Hexatoxin-Hv1a (ω-ACTX-Hv1; ω-Atracotoxin-HV1) is an orally active insecticidal neurotoxin containing an inhibitor cystine knot motif and a selective calcium channel inhibitor. ω-Hexatoxin-Hv1a blocks L-type voltage-dependent Ca2+ channels and reduces intracellular calcium ion concentration, thereby decreasing apoptosis, necroptosis and oxidative stress, and promoting cell recovery and energy level elevation. ω-Hexatoxin-Hv1a causes larval paralysis and death by impairing neurotransmission in the central nervous system of insects. It shows high injectable toxicity against insects of multiple orders, but exhibits weak oral toxicity. ω-Hexatoxin-Hv1a is widely applicable to studies related to ischemia-reperfusion injury, atopic dermatitis, and ischemic injury of cardiomyocytes and neurons.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ω-Hexatoxin-Hv1a

ω-Hexatoxin-Hv1a Chemical Structure

CAS No. : 193981-10-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of ω-Hexatoxin-Hv1a:

Other Forms of ω-Hexatoxin-Hv1a:

ω-Hexatoxin-Hv1a Related Antibodies

Top Publications Citing Use of Products

View All Calcium Channel Isoform Specific Products:

View All Isoforms
N-type calcium channel L-type calcium channel P/Q-type calcium channel T-type calcium channel Calcium Channel

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ω-Hexatoxin-Hv1a (ω-ACTX-Hv1; ω-Atracotoxin-HV1) is an orally active insecticidal neurotoxin containing an inhibitor cystine knot motif and a selective calcium channel inhibitor. ω-Hexatoxin-Hv1a blocks L-type voltage-dependent Ca2+ channels and reduces intracellular calcium ion concentration, thereby decreasing apoptosis, necroptosis and oxidative stress, and promoting cell recovery and energy level elevation. ω-Hexatoxin-Hv1a causes larval paralysis and death by impairing neurotransmission in the central nervous system of insects. It shows high injectable toxicity against insects of multiple orders, but exhibits weak oral toxicity. ω-Hexatoxin-Hv1a is widely applicable to studies related to ischemia-reperfusion injury, atopic dermatitis, and ischemic injury of cardiomyocytes and neurons[1][2][3].

IC50 & Target

L-type calcium channel

 

In Vitro

ω-Hexatoxin-Hv1a (10-50 nM; 3 h of reperfusion) inhibits ischemia/reperfusion-induced apoptosis, suppresses ischemia/reperfusion-induced necrosis, alleviates intracellular calcium overload, and promotes the recovery of cell index in CHO-K1 epithelial cells[1].
Recombinant ω-Hexatoxin-Hv1a (100-200 ng) retains immunoreactivity after fusion with GNA, which is confirmed by Western blotting analysis of 200 ng and 100 ng loaded samples of the intact Hv1a/GNA fusion protein[2].
ω-Hexatoxin-Hv1a (10-50 nM; 18 h) blocks AC-1001 H3-induced apoptosis in CHO-K1 cells in a dose-dependent manner in vitro. At 50 nM (18 h incubation), it reduces the apoptosis level to that of the control group, while 10 nM used alone does not alter the baseline apoptosis level[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

ω-Hexatoxin-Hv1a Related Antibodies

Apoptosis Analysis[1]

Cell Line: CHO-K1 Chinese hamster ovary epithelial cells
Concentration: 10 nM; 50 nM
Incubation Time: 3 h (reperfusion)
Result: Maintained CHO-K1 cell apoptosis levels at the normal condition level at 50 nM.
Showed no effect on apoptosis at 10 nM.
Maintained necrosis levels at the normal condition level at both 10 nM and 50 nM.
Reduced intracellular calcium ion concentration during reperfusion to levels correlating with reduced apoptosis and necrosis at both 10 nM and 50 nM.
Caused the cell index to return to pre-reperfusion values within 1 h of reperfusion start at both 10 nM and 50 nM, compared to the no-toxin group which returned to normal levels only after 5 h.

Apoptosis Analysis[3]

Cell Line: CHO-K1
Concentration: 10 nM (alone); 10-50 nM (co-treated with AC-1001 H3 peptide)
Incubation Time: 18 h (all conditions)
Result: Exhibited apoptosis level statistically identical to the control group when used alone at 10 nM for 18 h.
Decreased apoptosis level compared to AC-1001 H3 peptide alone when co-treated at 10 nM for 18 h.
Showed a dose-dependent reduction in AC-1001 H3-induced apoptosis at 10, 30, 50 nM for 18 h, with 50 nM resulting in apoptosis level statistically indistinguishable from the control group.
In Vivo

ω-Hexatoxin-Hv1a (46-184 μg/g insect; injection) causes dose-dependent paralysis and mortality in fifth stadium Mamestra brassicae larvae, with 90% mortality achieved at 184 μg/g insect[2].
ω-Hexatoxin-Hv1a (9.6 μg per larva; p.o.; daily; 4 days) alone via daily sucrose droplets has no insecticidal activity against fifth stadium Mamestra brassicae larvae[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Mamestra brassicae (fifth stadium, 40-70 mg)[2]
Dosage: 46 μg/g insect; 92 μg/g insect; 184 μg/g insect
Administration: injection
Result: Caused 20% mortality at 72 hours post-injection at 46 μg/g insect.
Caused 80% mortality at 72 hours post-injection at 92 μg/g insect.
Caused 90% mortality at 72 hours post-injection at 184 μg/g insect.
Induced paralysis in larvae injected with doses of 46 μg/g insect and above.
Significantly reduced survival compared to controls (P<0.001).
Animal Model: Mamestra brassicae (fifth stadium)[2]
Dosage: 9.6 μg per larva (daily, total 38.4 μg per larva)
Administration: p.o.; daily; 4 days
Result: Showed no reduction in larval growth compared to the BSA control group.
Showed no reduction in survival compared to the BSA control group.
Resulted in all larvae surviving to pupation, with no evidence of reduced feeding or paralysis.
Molecular Weight

4049.38

Formula

C162H247N49O61S6
CAS No.
Sequence

Ser-Pro-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Pro-Tyr-Asn-Glu-Asn-Cys-Cys-Ser-Gln-Ser-Cys-Thr-Phe-Lys-Glu-Asn-Glu-Asn-Gly-Asn-Thr-Val-Lys-Arg-Cys-Asp (Disulfide bridge:Cys4-Cys18, Cys11-Cys22, Cys17-Cys36)
Sequence Shortening

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (Disulfide bridge:Cys4-Cys18, Cys11-Cys22, Cys17-Cys36)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

ω-Hexatoxin-Hv1a Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

ω-Hexatoxin-Hv1a193981-10-1ω-ACTX-Hv1 ω-Atracotoxin-HV1InsecticideCalcium ChannelApoptosisNecroptosisCa2+ channelsCa channelsvoltage-gated calcium channelsmammalian voltage-gated calcium channelsinsect voltage-gated calcium channelsCHO-K1 cellsatopic dermatitisinsect larvaeepithelial cellscentral nervous system ganglionic neural transmissionischemic and reperfusion injuryinhibitor cystine knot motifInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ω-Hexatoxin-Hv1a
Cat. No.:
HY-P5142
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.