Exendin(9-39) amide (Synonyms: Avexitide)

Name: Exendin(9-39) amide
Brand: MedChemExpress
SKU: HY-P0264
Rating: 5.0 (34 reviews)

Cat. No.: HY-P0264 Purity: 99.78%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

Exendin(9-39) amide (Avexitide) is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for binding to GLP-1 receptors, thereby antagonizing the effects of excess GLP-1 secretion. Exendin(9-39) amide can be used to study postoperative hypoglycemia (PBH).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 133514-43-9

Size	Stock	Quantity
500 μg	In-stock	Estimated Time of Arrival: December 31
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
25 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	In-stock	Estimated Time of Arrival: December 31
100 mg	In-stock	Estimated Time of Arrival: December 31
200 mg	Get quote
500 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 34 publication(s) in Google Scholar

Other Forms of Exendin(9-39) amide:

Exendin(9-39) amide acetate In-stock

34 Publications Citing Use of MCE Exendin(9-39) amide

Bio/Physico-chemical Assay

: Exendin(9-39) amide purchased from MedChemExpress. Usage Cited in: Biomed Pharmacother. 2024 Jul 24:178:117202. [Abstract]; Idebenone augmented insulin secre tion at 11.1 mM glucose (p<0.001), and the insulinotropic action of idebenone was markedly reversed by Exendin (9− 39).

: Exendin(9-39) amide purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86. [Abstract]; Western blots showing the alteration of CGRP protein levels in the TNC treated with liraglutide and Exendin (9–39) (50 μg/kg; i.p.; 16 days).

: Exendin(9-39) amide purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86. [Abstract]; The density of CGRP-immunoreactive fibres in the TNC was increased in the CM and Exendin (9–39) (50 μg/kg; i.p.; 16 days) treated (CM + Exe(9–39)) groups compared with the sham group.

: Exendin(9-39) amide purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86. [Abstract]; Western blots showing the changes in c-fos protein expression in the TNC following liraglutide and Exendin (9–39) (50 μg/kg; i.p.; 16 days) administration.

: Exendin(9-39) amide purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86. [Abstract]; The immunofluorescence results for c-fos in the TNC showed that the number of c-fos immunoreactive cells in the Exendin (9–39) (50 μg/kg; i.p.; 16 days) treated group (CM + Exe(9–39), 72.33 ± 14.95) was higher than that of sham group (39.83 ± 13.23).

: Exendin(9-39) amide purchased from MedChemExpress. Usage Cited in: Br J Pharmacol. 2020 Aug;177(15):3389-3402. [Abstract]; The addition of Exendin‐9–39 (10 nM, 20 nM) eliminated the effect of Exendin‐4 on NO levels.

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description

In Vitro

GLP-1 plays a role in the control of fasting glucose. Avexitide (Exendin (9-39)), a truncated form of the GLP-1 agonist exendin-4, is a specific GLP-1 receptor antagonist^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Continuous subcutaneous infusion of Avexitide (Exendin (9-39)) significantly raises fasting blood glucose levels in SUR-1 ^-/- mice without affecting glucose tolerance^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Clinical Trial

Molecular Weight

3369.76

Formula

C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.

133514-43-9

Appearance

Solid

Color

White to pale purple

Sequence

Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Sequence Shortening

DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (14.84 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2968 mL	1.4838 mL	2.9676 mL
5 mM	0.0594 mL	0.2968 mL	0.5935 mL
10 mM	0.0297 mL	0.1484 mL	0.2968 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: PBS
Solubility: 100 mg/mL (29.68 mM); Clear solution; Need ultrasonic

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 99.81%

Select Batch:

Data Sheet (285 KB) SDS (252 KB)

COA (242 KB) LCMS (126 KB)

Handling Instructions (2659 KB)

References

[1]. Calabria AC, et al. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012 Oct;61(10):2585-91. [Content Brief]

[2]. De León DD, et al. Exendin-(9-39) corrects fasting hypoglycemia in SUR-1-/- mice by lowering cAMP in pancreatic beta-cells and inhibiting secretion. J Biol Chem. 2008 Sep 19;283(38):25786-93. [Content Brief]

Animal Administration
^[2]

Mice^[2]
Alzet miniosmotic pumps are implanted subcutaneously to deliver Avexitide (Exendin (9-39)) at a rate of 150 pmol/kg/min or vehicle (0.9% NaCl, 1% bovine serum albumin) for 2 weeks^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

[1]. Calabria AC, et al. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012 Oct;61(10):2585-91. [Content Brief]

[2]. De León DD, et al. Exendin-(9-39) corrects fasting hypoglycemia in SUR-1-/- mice by lowering cAMP in pancreatic beta-cells and inhibiting secretion. J Biol Chem. 2008 Sep 19;283(38):25786-93. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2968 mL	1.4838 mL	2.9676 mL	7.4189 mL
	5 mM	0.0594 mL	0.2968 mL	0.5935 mL	1.4838 mL
	10 mM	0.0297 mL	0.1484 mL	0.2968 mL	0.7419 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Exendin(9-39) amide Related Classifications

Metabolic Disease

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Exendin(9-39) amide133514-43-9AvexitideGLP ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Exendin(9-39) amide (Synonyms: Avexitide)

Customer Review

Other Forms of Exendin(9-39) amide:

Exendin(9-39) amide Related Antibodies

34 Publications Citing Use of MCE Exendin(9-39) amide

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity

Protocol

Purity & Documentation

References

Customer Review

Exendin(9-39) amide Related Antibodies

Molarity Calculator

Dilution Calculator

Complete Stock Solution Preparation Table

Exendin(9-39) amide Related Classifications

Keywords:

Your Recently Viewed Products:

Customer Review

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report