1. GPCR/G Protein
  2. Glucagon Receptor

Exendin 9-39 (Synonyms: Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2; DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2)

Cat. No.: HY-P0264 Purity: 96.69%
Data Sheet SDS Handling Instructions

Exendin (9-39) is a specific and competitive glucagon-like peptide-1 receptor antagonist.

For research use only. We do not sell to patients.
Exendin 9-39 Chemical Structure

Exendin 9-39 Chemical Structure

CAS No. : 133514-43-9

Size Price Stock Quantity
10 mM * 1 mL in Water USD 7206 In-stock
500 ug USD 204 In-stock
1 mg USD 324 In-stock
5 mg USD 972 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References

Description

Exendin (9-39) is a specific and competitive glucagon-like peptide-1 receptor antagonist.

In Vitro

GLP-1 plays a role in the control of fasting glucose. Exendin-(9-39), a truncated form of the GLP-1 agonist exendin-4, is a specific GLP-1 receptor antagonist in mice and humans. Exendin (9-39) significantly inhibits amino acid-stimulated insulin secretion in pancreatic islets isolated from neonates with KATPHI[1].

In Vivo

Insulin-to-glucose ratios are significantly lower during Exendin (9-39) infusion compared with vehicle[1]. Continuous subcutaneous infusion of exendin-(9-39) significantly raises fasting blood glucose levels in SUR-1 −/− mice without affecting glucose tolerance or insulin sensitivity[2].

Clinical Trial
View MoreCollapse
References
Animal Administration
[2]

Exendin (9-39) is formulated in 0.9% NaCl, 1% bovine serum albumin.

Mice: Alzet miniosmotic pumps are implanted subcutaneously to deliver exendin (9-39) at a rate of 150 pmol/kg/min or vehicle (0.9% NaCl, 1% bovine serum albumin) for 2 weeks[2]. MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
Molecular Weight

3369.76

Formula

C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.

133514-43-9

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

Solvent & Solubility

H2O

* "<1 mg/mL" means slightly soluble or insoluble. "≥" means soluble, but saturation unknown.

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin 9-39
Cat. No.:
HY-P0264
Quantity: