2. GPCR/G Protein
  3. GLP Receptor
  4. Exendin(9-39) amide acetate

Exendin(9-39) amide acetate  (Synonyms: Avexitide acetate)

Cat. No.: HY-P0264A Purity: 99.41%
COA
SDS
Handling Instructions Technical Support

Exendin(9-39) amide (Avexitide) acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 2051593-46-3

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 34 publication(s) in Google Scholar

Other Forms of Exendin(9-39) amide acetate:

Exendin(9-39) amide acetate Related Antibodies

Top Publications Citing Use of Products

34 Publications Citing Use of MCE Exendin(9-39) amide acetate

WB
Bio/Physico-chemical Assay
IF

    Exendin(9-39) amide acetate purchased from MedChemExpress. Usage Cited in: Biomed Pharmacother. 2024 Jul 24:178:117202.  [Abstract]

    Idebenone augmented insulin secre tion at 11.1 mM glucose (p<0.001), and the insulinotropic action of idebenone was markedly reversed by Exendin (9− 39).

    Exendin(9-39) amide acetate purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86.  [Abstract]

    Western blots showing the alteration of CGRP protein levels in the TNC treated with liraglutide and Exendin (9–39) (50 μg/kg; i.p.; 16 days).

    Exendin(9-39) amide acetate purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86.  [Abstract]

    The density of CGRP-immunoreactive fibres in the TNC was increased in the CM and Exendin (9–39) (50 μg/kg; i.p.; 16 days) treated (CM + Exe(9–39)) groups compared with the sham group.

    Exendin(9-39) amide acetate purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86.  [Abstract]

    Western blots showing the changes in c-fos protein expression in the TNC following liraglutide and Exendin (9–39) (50 μg/kg; i.p.; 16 days) administration.

    Exendin(9-39) amide acetate purchased from MedChemExpress. Usage Cited in: J Headache Pain. 2021 Jul 29;22(1):86.  [Abstract]

    The immunofluorescence results for c-fos in the TNC showed that the number of c-fos immunoreactive cells in the Exendin (9–39) (50 μg/kg; i.p.; 16 days) treated group (CM + Exe(9–39), 72.33 ± 14.95) was higher than that of sham group (39.83 ± 13.23).

    Exendin(9-39) amide acetate purchased from MedChemExpress. Usage Cited in: Br J Pharmacol. 2020 Aug;177(15):3389-3402.  [Abstract]

    The addition of Exendin‐9–39 (10 nM, 20 nM) eliminated the effect of Exendin‐4 on NO levels.

    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    Exendin(9-39) amide (Avexitide) acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research[1].

    Molecular Weight

    3369.76 (free base)

    Formula

    C149H234N40O47S·xC2HF3O2
    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
    Sequence Shortening

    DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
    Shipping

    Room temperature in continental US; may vary elsewhere.
    Storage

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

    Solvent & Solubility
    In Vitro: 

    H2O : 50 mg/mL (Need ultrasonic)

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation
    References
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    Exendin(9-39) amide acetate Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Keywords:

    Exendin(9-39) amide2051593-46-3AvexitideGLP ReceptorGLP-1 antagonistPostbariatric hypoglycemiaPBHInhibitorinhibitorinhibit

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Requested Quantity *

    Applicant Name *

    		 

    Salutation

    Email Address *

    		 

    Phone Number *

    Department

    		 

    Organization Name *

    City

    State

    Country or Region *

    		      

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Exendin(9-39) amide acetate
    Cat. No.:
    HY-P0264A
    Quantity:
    MCE Japan Authorized Agent:

    Customer Review

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Lot #

    Applicant Name *

    		 

    Email Address *

    Phone Number

    		 

    Department *

    Organization Name *

    		 

    Country or Region *

    Remarks

    SAFETY DATA SHEET (SDS)

    English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.