GpTx-1
GpTx-1 is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 1661050-12-9
- Formule: C176H271N53O45S7
- Masse moléculaire:4073.82
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
|
Nav1.3 0.0203 μM (IC50) |
Nav1.4 0.301 μM (IC50) |
Nav1.5 4.20 μM (IC50) |
Nav1.7 10 nM (IC50) |
Nav1.8 12.2 μM (IC50) |
Chemical Information
-
CAS No. 1661050-12-9
-
Masse moléculaire 4073.82
-
Formule C176H271N53O45S7
-
Sequence
Asp-Cys-Leu-Gly-Phe-Met-Arg-Lys-Cys-Ile-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Thr-His-Lys-Trp-Cys-Lys-Tyr-Val-Phe-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
-
Sequence Shortening
DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
GpTx-1 Related Classifications
HY-P1681 Related Classifications
Powered by Bioz