m3-Huwentoxin IV
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C170H271N53O46S6
- Masse moléculaire:3985.69
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
IC50: 3.3 nM (hNaV1.7), 6.8 nM (hNaV1.6), 7.2 nM (hNaV1.3), 8.4 nM (hNaV1.1), 11.9 nM (hNaV1.2), 369 nM (hNaV1.4), > 1000 nM (hNaV1.5), > 1000 nM (hNaV1.8)[1]
Chemical Information
-
Masse moléculaire 3985.69
-
Formule C170H271N53O46S6
-
Synonyms
m3-HwTx-IV
-
Sequence
Gly-Cys-Leu-Gly-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Trp-Gln-Ile-NH2 (Disulfide bridge: Cys2-Cys17,Cys9-Cys24,Cys16-Cys31)
-
Sequence Shortening
GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI-NH2 (Disulfide bridge: Cys2-Cys17,Cys9-Cys24,Cys16-Cys31)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
m3-Huwentoxin IV Related Classifications
HY-P5900 Related Classifications
Powered by Bioz