Jingzhaotoxin-III
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype.
For research use only. We do not sell to patients.
- CAS No.: 925463-91-8
- Formula: C174H241N47O46S6
- Molecular Weight:3919.45
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
IC50: 348 nM (Nav1.5 Channels)[1]
Chemical Information
-
CAS No. 925463-91-8
-
Molecular Weight 3919.45
-
Formula C174H241N47O46S6
-
Synonyms
β-TRTX-Cj1α
-
Sequence
Asp-Gly-Glu-Cys-Gly-Gly-Phe-Trp-Trp-Lys-Cys-Gly-Arg-Gly-Lys-Pro-Pro-Cys-Cys-Lys-Gly-Tyr-Ala-Cys-Ser-Lys-Thr-Trp-Gly-Trp-Cys-Ala-Val-Glu-Ala-Pro (Disulfide bridge: Cys4-Cys19; Cys11-Cys24; Cys18-Cys31)
-
Sequence Shortening
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP (Disulfide bridge: Cys4-Cys19; Cys11-Cys24; Cys18-Cys31)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Purity & Documentation
References
[1]. Rong M, et, al. Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5. FASEB J. 2011 Sep; 25(9): 3177-85. [Content Brief]
[2]. Xiao Y, et, al. Jingzhaotoxin-III, a novel spider toxin inhibiting activation of voltage-gated sodium channel in rat cardiac myocytes. J Biol Chem. 2004 Jun 18; 279(25): 26220-6. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz