1. Membrane Transporter/Ion Channel
  2. Sodium Channel Potassium Channel
  3. α-Dendrotoxin

α-Dendrotoxin (α-DTX) is a voltage-gated K+ channel blocker and an acid-sensing ion channel (ASIC) inhibitor. α-Dendrotoxin blocks Kv1.1, Kv1.2, Kv1.6 and D-type (ID) voltage-gated K+ channels, and reversibly inhibits slowly inactivating potassium currents. α-Dendrotoxin induces epilepsy-related behaviors in mice. α-Dendrotoxin can be used in studies related to tonic-clonic seizures.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

α-Dendrotoxin

α-Dendrotoxin Chemical Structure

CAS No. : 74504-53-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

α-Dendrotoxin (α-DTX) is a voltage-gated K+ channel blocker and an acid-sensing ion channel (ASIC) inhibitor. α-Dendrotoxin blocks Kv1.1, Kv1.2, Kv1.6 and D-type (ID) voltage-gated K+ channels, and reversibly inhibits slowly inactivating potassium currents. α-Dendrotoxin induces epilepsy-related behaviors in mice. α-Dendrotoxin can be used in studies related to tonic-clonic seizures[1][2][3].

IC50 & Target[1]

Kv1.1

 

Kv1.2

 

Kv1.6

 

In Vitro

α-Dendrotoxin (0.1-10 μM; 25 s sustained application, 0.1-3 μM; 5 s co-application, 30-100 nM; sustained application for outward current inhibition, 100 nM-1 μM; co-application for outward current inhibition) reversibly inhibits acid-sensing ion channel (ASIC) peak currents in cultured rat dorsal root ganglion neurons with an IC50 of 0.8 μM when applied in a sustained manner, and abolishes post-acid pulse transient outward currents in these neurons at nanomolar to micromolar concentrations, while co-application with acid has no effect on ASIC currents[1].
α-Dendrotoxin (1-2 µM) increases excitability of large layer 5 pyramidal neurons from rat neocortex by hyperpolarizing the action potential firing threshold by 4-8 mV and reducing the threshold current for action potential initiation by 46%, without altering action potential half-width[3].
α-Dendrotoxin (2 µM) inhibits 6% of the total slow potassium current in nucleated outside-out patches from somata of large layer 5 pyramidal neurons from rat neocortex[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

α-Dendrotoxin (0.08-0.24 nmol/mouse; i.c.v.) induces dose-dependent tonic-clonic seizures in CD1 mice, with a CD97 of 0.21 nmol/mouse for hindlimb tonic extension[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: CD1 mice (male, 18-24 g)[2]
Dosage: 0.08 nmol/mouse; 0.2 nmol/mouse; 0.21 nmol/mouse; 0.24 nmol/mouse
Administration: i.c.v.
Result: Elicited compulsive grooming, jaw opening, forelimb and hindlimb myoclonus, Straub tail, and opisthotonus.
Induced wild running, falling down, hindlimb myoclonus, hindlimb tonic extension, and frequent death in most mice at 0.2 and 0.24 nmol/mouse.
Reached a CD97 (dose inducing tonic extension in 97% of mice) of 0.21 nmol/mouse.
Caused tonic-clonic seizures in all mice treated with 0.21 nmol/mouse, and killed 9 out of 10 mice following tonic extension.
Molecular Weight

7048.01

Formula

C305H472N98O84S6

CAS No.
Sequence

{Pyr}-Pro-Arg-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Asp-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Arg-Phe-Asp-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Gly (disulfide bridge:Cys7-Cys57,Cys16-Cys40,Cys32-Cys53)

Sequence Shortening

{Pyr}-PRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG (disulfide bridge:Cys7-Cys57,Cys16-Cys40,Cys32-Cys53)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
α-Dendrotoxin
Cat. No.:
HY-P2707
Quantity:
MCE Japan Authorized Agent: