ADWX 1 TFA
Based on 1 publication(s) in Google Scholar
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases.
For research use only. We do not sell to patients.
- Purity : 98.37%
- Formula: C169H281N57O46S7.xC2HF3O2
- Molecular Weight:4071.85 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) ADWX 1 TFA
More
Biological Activity
Description
IC50 & Target
[1]|
Kv1.3 1.89 pM (IC50) |
Kv1.1 0.65 nM (IC50) |
In Vitro
ADWX 1 (1,10 nM, 1 h) TFA inhibits IL-2 and IFN-γ productions, and inhibits humans CD4+ CCR7- TEM cells activation selectively[2].
ADWX 1 (1,10 nM, 50 min) TFA reduces [Ca2+] in activated CD4+ CCR7- TCM cells from EAE rats[2].
ADWX 1 (1,10 nM, 1 h) TFA reduces NF-κB activation and suppresses Kv1.3 expression at both mRNA and protein levels preferentially in myelin basic protein (MBP) (HY-P77995)-stimulated CD4+ CCR7- T cells from EAE rats[2].
ADWX 1 (1,10 nM, 3 days) TFA suppresses Th17 activation but not differentiation in CD4+ CCR7- T cells[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
-
Cell Line:CD4+ CCR7- T cells from EAE rats.
-
Concentration:1, 10 nM, 10 nM.
-
Incubation Time:1 h.
-
Result:Suppressed Kv1.3 gene mRNA expression preferentially.
-
Cell Line:CD4+ CCR7- T cells from EAE rats
-
Concentration:1, 10 nM.
-
Incubation Time:1 h.
-
Result:Suppressed Kv1.3 protein expression preferentially.
In Vivo
ADWX 1 (5/10 mg/kg, s.c., 2 weeks) induces no pathological changes in the behavior or tissues of the rats (acute toxicity assay)[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Stable symptoms of acute experimental autoimmune encephalomyelitis (EAE) were induced by immunizing Sprague-Dawley rats[2].
-
Dosage:100 μg/kg/day, 3 days
-
Administration:Subcutaneous injection (s.c.).
-
Result:Reduced neurological scores compared with vehicle-treated rats on days 10, 11, 12, 13 and 14.
Reduced in inflammatory infiltrates and demyelination in the affected spinal cord significantly.
Inhibited IL-2 and IFN-γ productions.
Inhibited the T cell proliferation triggered by high and low concentrations of myelin antigen in a dose-dependent manner.
Decreased CD4+ CCR7- TEM cells.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4071.85 (free base)
-
Formula C169H281N57O46S7.xC2HF3O2
-
Color White to off-white
-
Sequence
Val-Gly-Ile-Asn-Val-Lys-Cys-Lys-His-Ser-Arg-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Thr-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)
-
Sequence Shortening
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Bioact Mater
Food-derived β-lactoglobulin nanofibrils: An efficacy, safe, and scalable solution to overcome oral insulin delivery challenges. [Abstract]2025 Nov 25:57:646-659. PMID: 41377894
Solvent & Solubility
In Vitro:
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
-
Research Protocol for Inflammation-related Diseases
The NLRP3 inflammasome is a cytosolic innate immune signaling platform that integrates priming signals and danger-signal activation to promote caspase-1 activation, maturation of IL-1β and IL-18, and gasdermin D-mediated pyroptotic cell death. The core experimental logic is to determine whether inflammatory disease phenotypes are driven by increased NLRP3 expression, ASC-containing inflammasome assembly, caspase-1 cleavage, GSDMD cleavage, and extracellular release of IL-1β/IL-18 rather than by nonspecific cell injury alone. The pathway is strongly linked to inflammation-related disease phenotypes because monosodium urate crystals activate NALP3/NLRP3 inflammasome signaling in gout-like crystal inflammation, cholesterol crystals activate NLRP3 inflammasomes in atherogenesis models, and DSS-induced intestinal inflammation has been reported to involve NLRP3 inflammasome activity. However, experimental colitis studies also show context-dependent protective effects of NLRP3 inflammasome co
-
Research Protocol for Cancer Immunology
Cancer immunology studies how the immune system recognizes, suppresses, edits, or fails to eliminate malignant cells through tumor antigen release, antigen presentation, T-cell priming, immune trafficking, tumor-cell killing, and feedback inhibition in the tumor microenvironment. The cancer-immunity cycle links tumor antigenicity, dendritic-cell priming, CD8+ T-cell infiltration, cytotoxic function, and immune-checkpoint regulation to tumor rejection or immune escape. Immune-checkpoint pathways such as PD-1/PD-L1 and CTLA-4 suppress antitumor T-cell activity and can be therapeutically blocked, but many tumors remain resistant because of poor antigen presentation, weak T-cell infiltration, suppressive myeloid cells, regulatory T cells, and tumor-intrinsic immune-exclusion programs. Unresolved questions include which immune-cell states predict response, how tumor-intrinsic pathways exclude immune cells, how myeloid suppression limits checkpoint blockade, and which combination strategies
Purity & Documentation
-
Data Sheet (298 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Han S, et al. Structural basis of a potent peptide inhibitor designed for Kv1.3 channel, a therapeutic target of autoimmune disease. J Biol Chem. 2008 Jul 4;283(27):19058-65. [Content Brief]
[2]. Li Z, et al. Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model. J Biol Chem. 2012 Aug 24;287(35):29479-94. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)