ADWX 1 TFA
Based on 1 publication(s) in Google Scholar
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98.37%
- Formel: C169H281N57O46S7.xC2HF3O2
- Molecular Weight:4071.85 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) ADWX 1 TFA
More
Biologische Aktivität
|
Kv1.3 1.89 pM (IC50) |
Kv1.1 0.65 nM (IC50) |
ADWX 1 (1,10 nM, 1 h) TFA inhibits IL-2 and IFN-γ productions, and inhibits humans CD4+ CCR7- TEM cells activation selectively[2].
ADWX 1 (1,10 nM, 50 min) TFA reduces [Ca2+] in activated CD4+ CCR7- TCM cells from EAE rats[2].
ADWX 1 (1,10 nM, 1 h) TFA reduces NF-κB activation and suppresses Kv1.3 expression at both mRNA and protein levels preferentially in myelin basic protein (MBP) (HY-P77995)-stimulated CD4+ CCR7- T cells from EAE rats[2].
ADWX 1 (1,10 nM, 3 days) TFA suppresses Th17 activation but not differentiation in CD4+ CCR7- T cells[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:CD4+ CCR7- T cells from EAE rats.
-
Concentration:1, 10 nM, 10 nM.
-
Incubation Time:1 h.
-
Result:Suppressed Kv1.3 gene mRNA expression preferentially.
-
Cell Line:CD4+ CCR7- T cells from EAE rats
-
Concentration:1, 10 nM.
-
Incubation Time:1 h.
-
Result:Suppressed Kv1.3 protein expression preferentially.
ADWX 1 (5/10 mg/kg, s.c., 2 weeks) induces no pathological changes in the behavior or tissues of the rats (acute toxicity assay)[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Stable symptoms of acute experimental autoimmune encephalomyelitis (EAE) were induced by immunizing Sprague-Dawley rats[2].
-
Dosage:100 μg/kg/day, 3 days
-
Administration:Subcutaneous injection (s.c.).
-
Result:Reduced neurological scores compared with vehicle-treated rats on days 10, 11, 12, 13 and 14.
Reduced in inflammatory infiltrates and demyelination in the affected spinal cord significantly.
Inhibited IL-2 and IFN-γ productions.
Inhibited the T cell proliferation triggered by high and low concentrations of myelin antigen in a dose-dependent manner.
Decreased CD4+ CCR7- TEM cells.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4071.85 (free base)
-
Formel C169H281N57O46S7.xC2HF3O2
-
Color White to off-white
-
Sequence
Val-Gly-Ile-Asn-Val-Lys-Cys-Lys-His-Ser-Arg-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Thr-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)
-
Sequence Shortening
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Bioact Mater
Food-derived β-lactoglobulin nanofibrils: An efficacy, safe, and scalable solution to overcome oral insulin delivery challenges. [Abstract]2025 Nov 25:57:646-659. PMID: 41377894
Lösungsmittel & Löslichkeit
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Reinheit & Dokumentation
-
Data Sheet (298 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Han S, et al. Structural basis of a potent peptide inhibitor designed for Kv1.3 channel, a therapeutic target of autoimmune disease. J Biol Chem. 2008 Jul 4;283(27):19058-65. [Content Brief]
[2]. Li Z, et al. Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model. J Biol Chem. 2012 Aug 24;287(35):29479-94. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
ADWX 1 TFA Related Classifications
HY-P1409A Related Classifications
Powered by Bioz