ProTx II
Based on 1 Customer Validation
ProTx II is a selective blocker of Nav1.7 sodium channels, with an IC50 value of 0.3 nM and a Ki of 0.389 nM against human NaV1.7. ProTx II selectively blocks spinal cord NaV1.7 by reducing conductance and altering voltage dependence of activation, preferentially binds to the splice region of aNaV1.5, and can also block sodium channel subtypes such as Nav1.4 and Nav1.6. ProTx II alleviates thermal hyperalgesia in diabetic mice and prevents the propagation of action potentials in nociceptors. ProTx II can be used for research related to painful diabetic neuropathy and pain disorders.
For research use only. We do not sell to patients.
- Purity: 98.34%
- CAS No.: 484598-36-9
- Formula: C168H250N46O41S8
- Molecular Weight:3826.59
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
|
hNav1.5 48 nM (IC50) |
h Nav1.7 0.3 nM (IC50) |
h Nav1.7 0.389 nM (Ki) |
ProTx-II potently inhibits aNaV1.5 expressed in Xenopus oocytes, with an IC50 of 173 nM; it exhibits approximately 12-fold higher affinity for aNaV1.5 compared to nNaV1.5[2].
ProTx-II potently inhibits aNaV1.5 expressed in EBNA-293 cells, with an IC50 of 48 nM; it exhibits approximately 25-fold higher affinity for aNaV1.5 compared to nNaV1.5 or nNaV1.5K211D[2].
ProTx-II potently and selectively inhibits wild-type hNaV1.7 channels in HEK-293 cells, with an IC50 of 0.3 nM, and exhibits at least 100-fold selectivity over the other 6 hNaV1 subtypes[3].
Mutation of Phe813 in hNaV1.7 abolishes the subtype selectivity of ProTx-II, reducing its inhibitory potency to a level similar to that against other hNaV1 subtypes, whereas the reverse mutation in hNaV1.2 does not enhance sensitivity to ProTx-II[3].
ProTx-II competitively displaces radiolabeled probes from their binding to hNaV1.7/β1 channels in HEK-293 cells, with a Ki value of 389 pM[3].
Unlabeled ProTx-II (4 h) displaces the binding of 125I-ProTx-II to hNaV1.7/β1 channels in HEK-293 cells, whereas a series of other sodium channel modulators do not interact with the ProTx-II binding site[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
ProTx II (4 ng; intrathecal injection; single dose) has no effect on the thermal nociceptive threshold in non-diabetic mice[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:ICR mice (male, 4-week-old, ~20g at study start, rendered diabetic via intravenous streptozotocin injection)[1]
-
Dosage:0.04 ng; 0.4 ng; 4 ng
-
Administration:i.t.; single dose
-
Result:Increased tail-flick latency dose-dependently and significantly in diabetic mice.
Produced a peak effect at 60 minutes post-administration with 4 ng dose, raising latency from 6.6 seconds to 15.2 seconds, with effects returning to baseline within 150 minutes.
Produced an additive antihyperalgesic effect when coadministered with 30 ng A803467 at 0.4 ng dose, raising latency from 6.3 seconds to 16.8 seconds at 30 minutes post-administration, compared to 11.7 seconds with 0.4 ng alone.
-
Animal Model:ICR mice (male, 4-week-old, ~20g at study start, nondiabetic, injected with citrate buffer vehicle)[1]
-
Dosage:4 ng; 0.4 ng (coadministered with 30 ng A803467 (HY-11079))
-
Administration:i.t.; single dose
-
Result:Did not significantly change tail-flick latency in nondiabetic mice at 4 ng dose.
Showed no effect on tail-flick latency when coadministered with 30 ng A803467 at 0.4 ng dose, with latency remaining near baseline (11.9 seconds to 12.4 seconds at 30 minutes post-administration).
Chemical Information
-
CAS No. 484598-36-9
-
Appearance Solid
-
Molecular Weight 3826.59
-
Formula C168H250N46O41S8
-
Color White to light yellow
-
Sequence
Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Trp (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25)
-
Sequence Shortening
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 100 mg/mL (26.13 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (296 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Tanaka K, et al. Antihyperalgesic effects of ProTx-II, a Nav1.7 antagonist, and A803467, a Nav1.8 antagonist, in diabetic mice. Journal of experimental pharmacology. 2015;7:11-6. [Content Brief]
[3]. Schmalhofer WA, et al. ProTx-II, a selective inhibitor of NaV1.7 sodium channels, blocks action potential propagation in nociceptors. Molecular pharmacology. 2008 Nov;74(5):1476-84. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2613 mL | 1.3066 mL | 2.6133 mL | 6.5332 mL |
| 5 mM | 0.0523 mL | 0.2613 mL | 0.5227 mL | 1.3066 mL | |
| 10 mM | 0.0261 mL | 0.1307 mL | 0.2613 mL | 0.6533 mL | |
| 15 mM | 0.0174 mL | 0.0871 mL | 0.1742 mL | 0.4355 mL | |
| 20 mM | 0.0131 mL | 0.0653 mL | 0.1307 mL | 0.3267 mL | |
| 25 mM | 0.0105 mL | 0.0523 mL | 0.1045 mL | 0.2613 mL |
ProTx II Related Classifications
HY-P1221 Related Classifications
Powered by Bioz