1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. ProTx II

ProTx II 

Cat. No.: HY-P1221
Handling Instructions

ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ProTx II Chemical Structure

ProTx II Chemical Structure

CAS No. : 484598-36-9

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors[1][2].

IC50 & Target

IC50: 0.3 nM (NaV1.7), 41 nM (Nav1.2), 102 nM (NaV1.3), 39 nM (NaV1.4), 79 nM (NaV1.5), 26 nM (NaV1.6), 146 nM (NaV1.8)[1]

Molecular Weight

3826.59

Formula

C₁₆₈H₂₅₀N₄₆O₄₁S₈

CAS No.

484598-36-9

Sequence

{Tyr}{Cys}{Gln}{Lys}{Trp}{Met}{Trp}{Thr}{Cys}{Asp}{Ser}{Glu}{Arg}{Lys}{Cys}{Cys}{Glu}{Gly}{Met}{Val}(Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25)

Sequence Shortening

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW(Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

ProTx IISodium ChannelNa channelsNa+ channelsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
ProTx II
Cat. No.:
HY-P1221
Quantity:
MCE Japan Authorized Agent: