TECTB Protein, Human (HEK293, His)
TECTB protein is a key noncollagenous component of the tegmental membrane of the inner ear that interacts with the stereocilia bundles of sensory hair cells. In response to sound stimulation, the movement of stereocilia relative to the tectorial membrane causes fluctuations in the hair cell membrane potential, converting sound into electrical signals. TECTB Protein, Human (HEK293, His) is the recombinant human-derived TECTB protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TECTB protein is a key noncollagenous component of the tegmental membrane of the inner ear that interacts with the stereocilia bundles of sensory hair cells. In response to sound stimulation, the movement of stereocilia relative to the tectorial membrane causes fluctuations in the hair cell membrane potential, converting sound into electrical signals. TECTB Protein, Human (HEK293, His) is the recombinant human-derived TECTB protein, expressed by HEK293 , with C-His labeled tag.
TECTB Protein stands as one of the principal non-collagenous constituents within the tectorial membrane, an extracellular matrix situated in the inner ear that envelops the neuroepithelium of the cochlea and makes contact with the stereocilia bundles of specialized sensory hair cells. In response to sound stimuli, causing movement of these hair cells relative to the tectorial membrane, the stereocilia deflect, resulting in fluctuations in the membrane potential of hair cells. This process serves as a mechanism for the transduction of sound into electrical signals. TECTB may exhibit the formation of homomeric filaments through self-association or heteromeric filaments when associated with alpha-tectorin. Additionally, it interacts with CEACAM16, further contributing to its functional role in the intricate architecture and sensory function of the tectorial membrane.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q96PL2/NP_478129.1 (K18-R304)
-
Gene ID6975 [NCBI]
-
Molecular Construction
-
N-term
-
TECTB (K18-R304)
Accession # Q96PL2/NP_478129.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TECTB; Beta-Tectorin; Tectorin Beta
-
AA Sequence
KSCAPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDTTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSIKKEAPFVLEASEIGSDLFAGVEAKGLSIRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGRDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVTCDKRKRLLRDQTGGVLVVELSLRSR
-
Predicted Molecular Mass
33.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
