1. Recombinant Proteins
  2. Others
  3. TECTB Protein, Human (HEK293, His)

TECTB protein is a key noncollagenous component of the tegmental membrane of the inner ear that interacts with the stereocilia bundles of sensory hair cells. In response to sound stimulation, the movement of stereocilia relative to the tectorial membrane causes fluctuations in the hair cell membrane potential, converting sound into electrical signals. TECTB Protein, Human (HEK293, His) is the recombinant human-derived TECTB protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TECTB protein is a key noncollagenous component of the tegmental membrane of the inner ear that interacts with the stereocilia bundles of sensory hair cells. In response to sound stimulation, the movement of stereocilia relative to the tectorial membrane causes fluctuations in the hair cell membrane potential, converting sound into electrical signals. TECTB Protein, Human (HEK293, His) is the recombinant human-derived TECTB protein, expressed by HEK293 , with C-His labeled tag.

Background

TECTB Protein stands as one of the principal non-collagenous constituents within the tectorial membrane, an extracellular matrix situated in the inner ear that envelops the neuroepithelium of the cochlea and makes contact with the stereocilia bundles of specialized sensory hair cells. In response to sound stimuli, causing movement of these hair cells relative to the tectorial membrane, the stereocilia deflect, resulting in fluctuations in the membrane potential of hair cells. This process serves as a mechanism for the transduction of sound into electrical signals. TECTB may exhibit the formation of homomeric filaments through self-association or heteromeric filaments when associated with alpha-tectorin. Additionally, it interacts with CEACAM16, further contributing to its functional role in the intricate architecture and sensory function of the tectorial membrane.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q96PL2/NP_478129.1 (K18-R304)

Gene ID

6975  [NCBI]

Molecular Construction
N-term
TECTB (K18-R304)
Accession # Q96PL2/NP_478129.1
His
C-term
Protein Length

Partial

Synonyms
Beta-tectorin; TECTB
AA Sequence

KSCAPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDTTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSIKKEAPFVLEASEIGSDLFAGVEAKGLSIRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGRDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVTCDKRKRLLRDQTGGVLVVELSLRSR

Predicted Molecular Mass
33.9 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TECTB Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TECTB Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TECTB Protein, Human (HEK293, His)
Cat. No.:
HY-P77225
Quantity:
MCE Japan Authorized Agent: