SjDX5-271
Based on 1 Customer Validation
SjDX5-271 is a small 3 kDa peptide. SjDX5-271 inhibits the TLR4/MyD88/NF-κB signaling pathway. SjDX5-271 induces cell polarization. SjDX5-271 alleviats hepatic inflammation. SjDX5-271 protects mice against liver ischemia-reperfusion injury.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98.90%
- CAS. Nr.: 2767993-76-8
- Formel: C137H215N47O49S
- Molecular Weight:3336.52
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
|
TLR4 |
Chemical Information
-
CAS. Nr. 2767993-76-8
-
Appearance Solid
-
Molecular Weight 3336.52
-
Formel C137H215N47O49S
-
Color White to off-white
-
Sequence
Tyr-Lys-Asn-Leu-Gly-Gly-Gln-Gln-Gln-Ser-Gly-Ser-Ser-Gln-Gly-Gln-Phe-Pro-Ser-Gly-Gln-Met-Gln-Gln-Gln-Gln-Arg-Pro-Gln-Gln
-
Sequence Shortening
YKNLGGQQQSGSSQGQFPSGQMQQQQRPQQ
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
DMSO : 20 mg/mL (5.99 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2997 mL | 1.4986 mL | 2.9971 mL | 7.4928 mL |
| 5 mM | 0.0599 mL | 0.2997 mL | 0.5994 mL | 1.4986 mL |