RFPL3 Protein, Human (His)
RFPL3 protein actively boosts Human Immunodeficiency Virus 1 (HIV-1) pre-integration complex activity during microbial infection. RFPL3 Protein, Human (His) is the recombinant human-derived RFPL3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
RFPL3 protein actively boosts Human Immunodeficiency Virus 1 (HIV-1) pre-integration complex activity during microbial infection. RFPL3 Protein, Human (His) is the recombinant human-derived RFPL3 protein, expressed by E. coli , with N-6*His labeled tag.
The RFPL3 protein enhances the activity of the Human Immunodeficiency Virus 1/HIV-1 pre-integration complex.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O75679 (K2-K317)
-
Gene ID10738
-
Molecular Construction
-
N-term
-
6*His
-
RFPL3 (K2-K317)
Accession # O75679 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RFPL3; RNF120; Ret Finger Protein Like 3; Ret Finger Protein-Like 3
-
AA Sequence
KRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)