1. Search Result
Search Result
Results for "

human CCR5

" in MedChemExpress (MCE) Product Catalog:

23

Inhibitors & Agonists

3

Peptides

2

Inhibitory Antibodies

4

Recombinant Proteins

1

Isotope-Labeled Compounds

1

Antibodies

5

Oligonucleotides

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-13004
    Maraviroc
    Maximum Cited Publications
    51 Publications Verification

    UK-427857

    CCR HIV Inflammation/Immunology Endocrinology Cancer
    Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
    Maraviroc
  • HY-12080A
    BX471 hydrochloride
    20+ Cited Publications

    ZK-811752 hydrochloride

    CCR Inflammation/Immunology Endocrinology
    BX471 hydrochloride (ZK-811752 hydrochloride) is a potent, selective non-peptide CCR1 antagonist with Ki of 1 nM for human CCR1, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
    BX471 hydrochloride
  • HY-103360
    J-113863
    3 Publications Verification

    CCR Inflammation/Immunology
    J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .
    J-113863
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-119101
    AZD-5672
    1 Publications Verification

    CCR Potassium Channel P-glycoprotein Inflammation/Immunology
    AZD-5672 is an orally active, potent, and selective CCR5 antagonist (IC50=0.32 nM). AZD-5672 shows moderate activity against the hERG ion channel (binding IC50=7.3 μM). AZD5672 is a substrate of human P-gp, and inhibits P-gp-mediated digoxin transport (IC50=32 μM). AZD-5672 can be used for the research of rheumatoid arthritis .
    AZD-5672
  • HY-117621

    CCR Metabolic Disease
    PF-0463481 is a potent and orally active dual CCR2/CCR5 antagonist with comparable human and rodent CCR2 potency (rat IC50=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC50=470 nM). PF-0463481 is safe and well-tolerated and has the potential for the study of diabetic nephropathy .
    PF-04634817
  • HY-117621A

    CCR Metabolic Disease
    PF-0463481 succinate is a potent and orally active dual CCR2/CCR5 antagonist with comparable human and rodent CCR2 potency (rat IC50=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC50=470 nM). PF-0463481 succinate is safe and well-tolerated and has the potential for the study of diabetic nephropathy .
    PF-04634817 succinate
  • HY-107401

    SCH-351125

    HIV CCR Calcium Channel Infection
    Ancriviroc (SCH-351125) is an orally active CCR5 antagonist with an IC50 value of 13 nM against hCCR5. Ancriviroc specifically binds to hCCR5, blocks ligand-induced signal transduction, calcium influx, GTPγS binding, chemotaxis, ligand binding, and HIV-1 entry, induces conformational changes in CCR5, and inhibits infection and replication of R5-tropic HIV-1 .
    Ancriviroc
  • HY-P4087

    HIV Infection Cancer
    Cys(Npys)-(Arg)9 is a synthetic cationic cell-penetrating peptide with a reversible thiol-reactive nitropyridyl (Npys) group. Cys(Npys)-(Arg)9 efficiently mediates the internalization and delivery of various "cargo" such as proteins and antibodies by forming reversible disulfide bonds with surface-exposed cysteine residues. Cys(Npys)-(Arg)9 endows TALEN proteins with cell-penetrating activity, enabling gene knockout in mammalian cells and protein transduction in wheat microspores. Cys(Npys)-(Arg)9 can be conjugated with antibodies to form cationized IgG for enhancing endosomal escape of oligonucleotides, or form siRNA delivery complexes. When the molar ratio of Cys(Npys)-(Arg)9 to loaded molecules is higher than 1:1, it exerts certain cytotoxic effects on cells. Cys(Npys)-(Arg)9 can be used in studies related to oral squamous cell carcinoma and HIV infection .
    Cys(Npys)-(Arg)9
  • HY-RS02160

    Small Interfering RNA (siRNA) CCR Others

    CCR5 Human Pre-designed siRNA Set A contains three designed siRNAs for CCR5 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    CCR5 Human Pre-designed siRNA Set A
    CCR5 Human Pre-designed siRNA Set A
  • HY-13004S

    Isotope-Labeled Compounds CCR HIV Inflammation/Immunology Endocrinology Cancer
    Maraviroc-d6 (UK-427857-d6) is the deuterium labeled Maraviroc. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV .
    Maraviroc-d6
  • HY-174743

    mRNA Inflammation/Immunology
    Human CCR5 mRNA encodes the human C-C motif chemokine receptor 5 (CCR5) protein, a member of the beta chemokine receptor family. CCR5 is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. It may also play a role in granulocyte lineage proliferation and differentiation.
    Human CCR5 mRNA
  • HY-P991541

    CCR HIV Infection
    HGS101 is a fully human CCR5 monoclonal antibody with high affinity to CCR5. HGS101 binds to the 2nd extracellular loop (ECL-2) and acts as a signal antagonist. HGS101 restores Maraviroc (HY-13004) inhibition of Maraviroc-resistant HIV-1 infection of PBMCs. HGS101 shows anti-HIV activity by inhibiting CCR5 signaling in simian immunodeficiency virus-uninfected RMs models .
    HGS101
  • HY-13004R

    UK-427857 (Standard)

    Reference Standards CCR HIV Inflammation/Immunology Endocrinology Cancer
    Maraviroc (Standard) is the analytical standard of Maraviroc. This product is intended for research and analytical applications. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
    Maraviroc (Standard)
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-B0155

    SCH 417690; SCH-D; MK-7690 free base

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc
  • HY-100584R

    Erythromycin Cyclocarbonate (Standard)

    Reference Standards Bacterial Antibiotic Infection
    Maraviroc (Standard) is the analytical standard of Maraviroc. This product is intended for research and analytical applications. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
    Davercin (Standard)
  • HY-174753

    mRNA Inflammation/Immunology
    Human CCL3L1 mRNA encodes the human C-C motif chemokine ligand 3 like 1 (CCL3L1) protein. It is a ligand for CCR1, CCR3 and CCR5.
    Human CCL3L1 mRNA
  • HY-174752

    mRNA Inflammation/Immunology
    Human CCL4L1 mRNA encodes the human C-C motif chemokine ligand 4 like 1 (CCL4L1) protein, a chemokine that can induce chemotaxis of cells expressing CCR5 or CCR1.
    Human CCL4L1 mRNA
  • HY-B0155B

    SCH 417690 malate; SCH-D malate; MK-7690

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc malate
  • HY-P991843

    CCR Inflammation/Immunology
    Anti-CCR5 Antibody (HEK/1/85a/7a) recognizes an epitope on human CCR5. CCR5 is a seven-transmembrane G-protein-coupled receptor (GPCR). Recommend Isotype Controls: Rat IgG2b kappa, Isotype Control (HY-P990682) .
    Anti-CCR5 Antibody (HEK/1/85a/7a)
  • HY-174751

    mRNA Inflammation/Immunology
    Human CCL5 mRNA encodes the human C-C motif chemokine ligand 5 (CCL5) protein, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. CCL5 is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor.
    Human CCL5 mRNA
  • HY-103360R

    Reference Standards CCR Inflammation/Immunology
    J-113863 (Standard) is the analytical standard of J-113863 (HY-103360). This product is intended for research and analytical applications. J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .
    J-113863 (Standard)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: