pTH (1-34) amide (human) 

PTH (1-34) amide human is a type 1 PTH/PTHrP receptor agonist. PTH (1-34) amide human activates adenylate cyclase and phospholipase C pathways, thereby mediating mineral ion homeostasis and bone metabolism regulation. PTH (1-34) amide human increases serum calcium, decreases serum phosphorus, regulates renal excretion, while inducing the inhibition of endogenous PTH (1-84) and the increase of 1,25-dihydroxyvitamin D2 and bone resorption. PTH (1-34) amide human stimulates phosphatidylcholine hydrolysis via phospholipase D mediation, and its hypercalcemic effect is inhibited by human PTH-(7-84). PTH (1-34) amide human can be used in the research of diseases related to humoral hypercalcemia of malignancy^[1][2][3][4].

pTH (1-34) amide human (3 nM; 72 h) stimulates bone resorption in neonatal mouse CD-1 strain calvariae, and this effect is inhibited by co-treatment with hPTH-(7-84)^[1].
pTH (1-34) amide human (3 nM; 45 min) induces submaximal cAMP accumulation in ROS 17/2.8 rat osteosarcoma cells, and this response is not inhibited by hPTH-(7-84)^[1].
pTH (1-34) amide human (2-3 nmol/L; 10 min) potently stimulates adenylyl cyclase activity in confluent SaOS-2 human osteosarcoma cells with an EC₅₀ of approximately 2-3 nmol/L, displaying identical potency to hPTHrP(1-36), Tyr³⁶hPTHrP(1-36)amide, and hPTHrP(1-40)^[2].
pTH (1-34) amide human (0.1-10 nM; 30 min) stimulates phosphatidylcholine hydrolysis in UMR-106 osteoblastic osteosarcoma cells with equivalent potency to bovine PTH-(1-34) and human PTH-related peptide-(1-34)^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4116.73

C₁₈₁H₂₉₂N₅₆O₅₀S₂

83139-29-1

Solid

White to off-white

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-NH2

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

• [1]. Divieti P, John MR, Jüppner H, et al.. Human PTH-(7-84) inhibits bone resorption in vitro via actions independent of the type 1 PTH/PTHrP receptor. Endocrinology. 2002 Jan;143(1):171-6.  [Content Brief]

  [2]. Everhart-Caye M, Inzucchi SE, Guinness-Henry J, et al.. Parathyroid hormone (PTH)-related protein(1-36) is equipotent to PTH(1-34) in humans. The Journal of clinical endocrinology and metabolism. 1996 Jan;81(1):199-208.  [Content Brief]

  [3]. Strid H, Care A, Jansson T, et al.. Parathyroid hormone-related peptide (38-94) amide stimulates ATP-dependent calcium transport in the Basal plasma membrane of the human syncytiotrophoblast. The Journal of endocrinology. 2002 Nov;175(2):517-24.  [Content Brief]

  [4]. Singh AT, Kunnel JG, Strieleman PJ, et al.. Parathyroid hormone (PTH)-(1-34), [Nle(8,18),Tyr34]PTH-(3-34) amide, PTH-(1-31) amide, and PTH-related peptide-(1-34) stimulate phosphatidylcholine hydrolysis in UMR-106 osteoblastic cells: comparison with effects of phorbol 12,13-dibutyrate. Endocrinology. 1999 Jan;140(1):131-7.  [Content Brief]