pTH (1-34) amide (human)
Based on 1 Customer Validation
PTH (1-34) amide human is a type 1 PTH/PTHrP receptor agonist. PTH (1-34) amide human activates adenylate cyclase and phospholipase C pathways, thereby mediating mineral ion homeostasis and bone metabolism regulation. PTH (1-34) amide human increases serum calcium, decreases serum phosphorus, regulates renal excretion, while inducing the inhibition of endogenous PTH (1-84) and the increase of 1,25-dihydroxyvitamin D2 and bone resorption. PTH (1-34) amide human stimulates phosphatidylcholine hydrolysis via phospholipase D mediation, and its hypercalcemic effect is inhibited by human PTH-(7-84). PTH (1-34) amide human can be used in the research of diseases related to humoral hypercalcemia of malignancy.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté : 99.96%
- CAS No.: 83139-29-1
- Formule: C181H292N56O50S2
- Masse moléculaire:4116.73
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Protocole
- Pureté et documentation
- Références
-
Help & FAQs
Voir tous les produits spécifiques à Isoform Phospholipase
More
Activité biologique
Description
IC50 & Target
[1]|
PLC |
PTH1R |
In Vitro
pTH (1-34) amide human (3 nM; 72 h) stimulates bone resorption in neonatal mouse CD-1 strain calvariae, and this effect is inhibited by co-treatment with hPTH-(7-84)[1].
pTH (1-34) amide human (3 nM; 45 min) induces submaximal cAMP accumulation in ROS 17/2.8 rat osteosarcoma cells, and this response is not inhibited by hPTH-(7-84)[1].
pTH (1-34) amide human (2-3 nmol/L; 10 min) potently stimulates adenylyl cyclase activity in confluent SaOS-2 human osteosarcoma cells with an EC50 of approximately 2-3 nmol/L, displaying identical potency to hPTHrP(1-36), Tyr36hPTHrP(1-36)amide, and hPTHrP(1-40)[2].
pTH (1-34) amide human (0.1-10 nM; 30 min) stimulates phosphatidylcholine hydrolysis in UMR-106 osteoblastic osteosarcoma cells with equivalent potency to bovine PTH-(1-34) and human PTH-related peptide-(1-34)[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 83139-29-1
-
Appearance Solid
-
Masse moléculaire 4116.73
-
Formule C181H292N56O50S2
-
Color White to off-white
-
Sequence
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-NH2
-
Sequence Shortening
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
In Vitro:
DMSO : 100 mg/mL (24.29 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
Select the appropriate dissolution method based on your experimental animal and administration route.
- For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
- To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for In Vivo experiments, it is recommended to prepare freshly and use it on the same day.
- The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: 10% DMSO 40% PEG300 5% Tween-80 45% Saline
Solubility: ≥ 2.5 mg/mL (0.61 mM); Clear solution
This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.
Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
Add each solvent one by one: 10% DMSO 90% (20% SBE-β-CD in Saline)
Solubility: ≥ 2.5 mg/mL (0.61 mM); Clear solution
This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
-
%DMSO +
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
-
%+
-
+%Tween-80 + +
-
%Saline +
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Working solution concentration: 0.22 mg/mL
Method for preparing stock solution: mg drug dissolved in μL DMSO. Stock solution concentration: mg/mL. * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
1. Take μL DMSO stock solution;
2. Add μL .
μL , mix evenly;
3. Then add μL Tween 80, mix evenly;
4. Then add μL
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Pureté et documentation
-
Fiche technique (273 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Divieti P, John MR, Jüppner H, et al.. Human PTH-(7-84) inhibits bone resorption in vitro via actions independent of the type 1 PTH/PTHrP receptor. Endocrinology. 2002 Jan;143(1):171-6. [Content Brief]
[2]. Everhart-Caye M, Inzucchi SE, Guinness-Henry J, et al.. Parathyroid hormone (PTH)-related protein(1-36) is equipotent to PTH(1-34) in humans. The Journal of clinical endocrinology and metabolism. 1996 Jan;81(1):199-208. [Content Brief]
[3]. Strid H, Care A, Jansson T, et al.. Parathyroid hormone-related peptide (38-94) amide stimulates ATP-dependent calcium transport in the Basal plasma membrane of the human syncytiotrophoblast. The Journal of endocrinology. 2002 Nov;175(2):517-24. [Content Brief]
[4]. Singh AT, Kunnel JG, Strieleman PJ, et al.. Parathyroid hormone (PTH)-(1-34), [Nle(8,18),Tyr34]PTH-(3-34) amide, PTH-(1-31) amide, and PTH-related peptide-(1-34) stimulate phosphatidylcholine hydrolysis in UMR-106 osteoblastic cells: comparison with effects of phorbol 12,13-dibutyrate. Endocrinology. 1999 Jan;140(1):131-7. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2429 mL | 1.2146 mL | 2.4291 mL | 6.0728 mL |
| 5 mM | 0.0486 mL | 0.2429 mL | 0.4858 mL | 1.2146 mL | |
| 10 mM | 0.0243 mL | 0.1215 mL | 0.2429 mL | 0.6073 mL | |
| 15 mM | 0.0162 mL | 0.0810 mL | 0.1619 mL | 0.4049 mL | |
| 20 mM | 0.0121 mL | 0.0607 mL | 0.1215 mL | 0.3036 mL |
pTH (1-34) amide (human) Related Classifications
HY-P4821 Related Classifications
Powered by Bioz
Keywords
- pTH (1-34) amide (human)
- 83139-29-1
- PTHR
- Adenylate Cyclase
- Phospholipase
- Parathyroid hormone receptor
- Adenylyl cyclase
- 1
- 25-dihydroxyvitamin D 2
- CD-1 strain calvariae
- phosphatidylcholine transphosphatidylation
- phospholipase C
- ROS 17/2.8 rat osteosarcoma cells
- bone resorption
- bone metabolism
- type 1 PTH/PTHrP receptor
- mineral ion homeostasis
- adenylate cyclase
- Inhibitor
- inhibitor
- inhibit