PDGF-BB Protein, Mouse (His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development. Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis. PDGF-BB Protein, Mouse (His) is the recombinant mouse-derived PDGF-BB protein, expressed by E. coli , with C-6*His labeled tag. The total length of PDGF-BB Protein, Mouse (His) is 109 a.a., with molecular weight of ~15.0 kDa.

The PDGF-BB Protein is a pivotal member of the PDGF/VEGF growth factor family, indicating its crucial role in cellular signaling and tissue development. As part of this growth factor family, PDGF-BB likely shares conserved structural and functional characteristics with related proteins, contributing to cell growth, angiogenesis, and vascular development. Its membership in the PDGF/VEGF growth factor family highlights its significance in orchestrating essential physiological processes necessary for tissue homeostasis. The study of PDGF-BB provides insights into its specific functions within the context of the growth factor family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in vascular development and maintenance. Further exploration of PDGF-BB's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

Measured in a cell proliferation assay using Balb/3T3 cells. The ED₅₀ this effect is ≤23 ng/mL, corresponding to a specific activity is ≥4.34×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 cells. The ED₅₀ this effect is 6.358 ng/mL, corresponding to a specific activity is 1.57×10⁵ units/mg.

Mouse

E. coli

C-6*His

AAH53430.1 (S82-T190)

18591  [NCBI]

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.