Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
19 Results for "
bone destruction,
" in MedChemExpress (MCE) Product Catalog:
Products (19)
19 Results for "bone destruction," in MCE Product Catalog:
54
54 Publications Verification
Cat. No.: HY-123606
CAS No.: 1652629-23-6
Target:
Research Areas:
GSK484 is a PAD4 inhibitor that effectively inhibits protein citrullination and the formation of neutrophil extracellular traps (NETs) by blocking the catalytic activity of PAD4. GSK484 suppresses the production of histone H3, MHC-I expression, CD8 + T cell activation, proliferation and inflammatory cytokine release. GSK484 reduces inflammation and bone destruction in collagen-induced rheumatoid arthritis, alleviates pain and mast cell activation in sickle cell disease, and improves myocardial ischemia-reperfusion injury and experimental colitis. In addition, GSK484 restores intestinal microbial homeostasis by reversing ferroptosis-induced dysbiosis. GSK484 can be used to study the disease mechanisms of rheumatoid arthritis, sickle cell disease, thrombosis, myocardial injury, colitis and other conditions .
4
4 Cited Publications
Research Areas:
Ki20227 is an orally active and highly selective c-Fms tyrosine kinase (CSF1R) inhibitor with IC50s of 2 nM, 12 nM, 451 and 217 nM for CSF1R, VEGFR2 (vascular endothelial growth factor receptor-2), c-Kit (stem cell factor receptor) and PDGFRβ (platelet-derived growth factor receptor β). Ki20227 suppresses osteoclast differentiation and osteolytic bone destruction .
1
Category:
Alkaloids Phenols Polyphenols Plants Lauraceae Disease Research Fields Isoquinoline Alkaloids Inflammation/Immunology Litsea cubeba (Lour.) Pers.
Target:
Cat. No.: HY-P99111
CAS No.: 476181-74-5
Synonyms: CNTO-148
Research Areas:
Cat. No.: HY-P99259
CAS No.: 1613144-80-1
Synonyms: FPA 008; Anti-Human CSF1R Recombinant Antibody
Target:
Research Areas:
GLPG0259 is a ATP-competitive inhibitor of MAPK-activated protein kinase 5 (MK5) with oral activity. GLPG0259 reduces inflammation and bone destruction in a mouse model of collagen-induced arthritis. GLPG0259 also inhibited the metastasis of prostate cancer (PCa) cells .
Cat. No.: HY-P4191A
Target:
Research Areas:
Cat. No.: HY-P2612
CAS No.: 199999-60-5
Target:
Research Areas:
Cat. No.: HY-155487
CAS No.: 1404380-58-0
Target:
Research Areas:
JTE-151 is an orally active, selective RORγ antagonist with IC50 values of 20.6 nM, 41.8 nM and 32.2 nM against hRORγ, rRORγ and mRORγ, respectively . JTE-151 reduces the production of IL-17. JTE-151 alleviates paw swelling and bone destruction in arthritis models. JTE-151 can be used in research related to rheumatoid arthritis, collagen-induced arthritis, experimental autoimmune encephalomyelitis, psoriasis, multiple sclerosis and inflammatory bowel disease .
Cat. No.: HY-P2612A
Target:
Category:
Alkaloids Phenols Plants Lauraceae Disease Research Fields Inflammation/Immunology Litsea cubeba (Lour.) Pers.
Target:
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Synonyms: Olpadronate; OLP
Target:
Research Areas:
Olpadronic acid (Olpadronate) is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .
Cat. No.: HY-N12740
CAS No.: 111216-63-8
Category:
Cat. No.: HY-106431R
CAS No.: 63132-39-8
Synonyms: Olpadronate (Standard); OLP (Standard)
Research Areas:
Olpadronic acid (Standard) is the analytical standard of Olpadronic acid. This product is intended for research and analytical applications. Olpadronic acid is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .
Cat. No.: HY-10408R
CAS No.: 623142-96-1
Target:
Research Areas:
Ki20227 (Standard) is the analytical standard of Ki20227 (HY-10408). This product is intended for research and analytical applications. Ki20227 is an orally active and highly selective c-Fms tyrosine kinase (CSF1R) inhibitor with IC50s of 2 nM, 12 nM, 451 and 217 nM for CSF1R, VEGFR2 (vascular endothelial growth factor receptor-2), c-Kit (stem cell factor receptor) and PDGFRβ (platelet-derived growth factor receptor β). Ki20227 suppresses osteoclast differentiation and osteolytic bone destruction .
Cat. No.: HY-165564
CAS No.: 113759-19-6
Target:
Research Areas:
SM-8849 is a thiazole derivative with anti-arthritis activity. SM-8849 specifically targets and inactivates T cells involved in delayed-type hypersensitivity (DTH) reactions, thereby inhibiting the core immunopathological process of arthritis, but has little effect on the humoral immune process such as antibody production. In a mouse arthritis model induced by Type II Collagen (HY-NP003), SM-8849 significantly alleviated clinical symptoms, reduced bone destruction and joint damage. SM-8849 can be used for the study of autoimmune diseases such as rheumatoid arthritis .
Cat. No.: HY-181596
Target:
Research Areas:
WJH-C19 is an orally active RIPK1 inhibitor with an IC50 of 5.7 nM. WJH-C19 inhibits the RIPK1/RIPK3/MLKL signaling axis, blocks RIPK1 phosphorylation, suppresses the phosphorylation of downstream RIPK3 and MLKL, disrupts necrosome formation, and exhibits protective effects against necroptosis (Apoptosis) in multiple cell lines. WJH-C19 ameliorates symptoms of inflammatory bowel disease in a mouse colitis model by regulating the necroptosis pathway. WJH-C19 alleviates inflammation and bone destruction in a mouse model of rheumatoid arthritis. WJH-C19 is applicable to research related to inflammatory bowel disease and rheumatoid arthritis .
Cat. No.: HY-L210
1,983 compounds
Rheumatoid Arthritis (RA) is a autoimmune disease characterized by persistent joint inflammation. The pathology of RA includes immune cell infiltration, synovial lining proliferation, pannus formation, and the destruction of joint cartilage and bone, which is highly disabling. Due to long-term chronic inflammation, RA not only severely affects the quality of life of patients but can also damage multiple organs, leading to lung diseases, cardiovascular diseases, and malignant tumors. The pathogenesis of RA is complex, involving genetic, environmental, and immune factors. With the advancement of high-throughput screening technology, screening for compounds targeting JAK, CCR, MEK, MMP targets may contribute to the development of more effective drugs against Rheumatoid Arthritis (RA).
MCE has collected 1,983 small molecule compounds with definite or potential anti-rheumatoid arthritis activity. This library is of significant value for researching the anti-RA drugs.
- 1
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
