Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
14 Results for "
MIP-1β
" in MedChemExpress (MCE) Product Catalog:
Products (14)
14 Results for "MIP-1β" in MCE Product Catalog:
29
Category:
Neurological Disease Ketones, Aldehydes, Acids Plants Umbelliferae Disease Research Fields Endocrinology Echinacea angustifolia DC. Cancer
Target:
3
3 Cited Publications
Cat. No.: HY-P7257
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
1
1 Cited Publications
Cat. No.: HY-P71889
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
Cat. No.: HY-P5523A
Research Areas:
Cat. No.: HY-P4191A
Target:
Research Areas:
Cat. No.: HY-P5523
CAS No.: 592520-07-5
Research Areas:
Cat. No.: HY-149650
CAS No.: 2374139-51-0
Target:
Research Areas:
TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells [1].
Cat. No.: HY-149650A
CAS No.: 3020639-70-4
Target:
Research Areas:
TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells [1].
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Cat. No.: HY-P71899
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
Cat. No.: HY-P700165AF
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
Cat. No.: HY-P74342
Purity: ≥ 90%, as determined by reducing SDS-PAGE.
Synonyms: CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse MIP-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
Species:
Source:
Cat. No.: HY-P701233
Purity: ≥ 95%, as determined by reducing SDS-PAGE.
Synonyms: CCL4L1; MIP-1-Beta; Prev. CCL4L; SCYA4L1; Prev. SCYA4L; SCYA4L2; LAG-1; LAG1; Monocyte Adherence-Induced Protein 5-Alpha; Chemokine (C-C Motif) Ligand 4-Like 1, Telomeric; Macrophage Inflammatory Protein 1-Beta; Chemokine (C-C Motif) Ligand 4-Like 1; Lymp
- 1
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
