2. Search Result
Search Result
Results for "

MIP-1β

" in MedChemExpress (MCE) Product Catalog:

7

Inhibitors & Agonists

4

Peptides

1

Natural
Products

5

Recombinant Proteins

1

Antibodies

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-B0498
    Bindarit
    25+ Cited Publications

    AF2838

    		 CCR Neurological Disease Inflammation/Immunology Endocrinology Cancer
    Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity [1].
    Bindarit
  • HY-P5523A
    iE-DAP dihydrochloride

    		NOD-like Receptor (NLR) NF-κB Interleukin Related Metabolic Disease
    iE-DAP dihydrochloride is a Nod1 agonist. iE-DAP dihydrochloride activates NOD1, which in turn activates the NF-κB signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP dihydrochloride downregulates the expression of ZO-1 and Occludin genes. iE-DAP dihydrochloride increases the secretion of IL-6, GRO-α, MCP-1, IL-8 and MIP-1β in term human trophoblast cell cultures. iE-DAP dihydrochloride triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP dihydrochloride can be used in studies related to mastitis and preterm birth [1] .
    iE-DAP dihydrochloride
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) [1].
    Met-RANTES (human) acetate
  • HY-P5523
    iE-DAP

    		NOD-like Receptor (NLR) NF-κB Interleukin Related Metabolic Disease
    iE-DAP is a Nod1 agonist. iE-DAP activates NOD1, which in turn activates the NF-κB signaling pathway and MLCK signaling pathway, inducing cellular inflammatory responses and tight junction disruption. iE-DAP downregulates the expression of ZO-1 and Occludin genes. iE-DAP increases the secretion of IL-6, GRO-α, MCP-1, IL-8 and MIP-1β in term human trophoblast cell cultures. iE-DAP triggers preterm birth in pregnant mice, reduces fetal body weight, and induces fetal inflammation. iE-DAP is applicable to research related to mastitis and preterm birth [1] .
    iE-DAP
  • HY-149650
    TLR4 agonist-1

    		Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells [1].
    TLR4 agonist-1
  • HY-149650A
    TLR4 agonist-1 TEA

    		Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells [1].
    TLR4 agonist-1 TEA
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) [1].
    Met-RANTES (human)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: