MAGEA8 Protein, Human (His, Strep)
MAGEA8 Protein, Human (His, Strep) is the recombinant human-derived MAGEA8, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MAGEA8 Protein, Human (His, Strep) is the recombinant human-derived MAGEA8, expressed by E. coli , with Strep, His labeled tag. ,
MAGEA8 is a protein with incompletely understood functions, potentially involved in embryonal development and aspects of tumor transformation or progression. by similar: Other MAGEA family members are studied as targets in cancer immunotherapy.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P43361 (M1-V318)
-
Gene ID4107
-
Protein Length
Full Length
-
Synonyms
MAGEA8; Melanoma-Associated Antigen 8; Prev. MAGE8; Cancer/Testis Antigen 1.8; CT1.8; MGC2182; MAGE-8 Antigen; Melanoma Antigen Family A, 8; Cancer/Testis Antigen Family 1, Member 8; Alternative Protein MAGEA8; MAGE Family Member A8; Melanoma Antigen Fami
-
AA Sequence
MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
-
Predicted Molecular Mass
38.4 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
