PRDX6 Protein, Mouse (His)
Based on 1 Customer Validation
PRDX6 Protein, Mouse (His) is the recombinant mouse-derived PRDX6, expressed by E. coli , with C-6*His labeled tag. ,
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PRDX6 Protein, Mouse (His) is the recombinant mouse-derived PRDX6, expressed by E. coli , with C-6*His labeled tag. ,
PRDX6, a thiol-specific peroxidase, demonstrates a crucial role in cellular defense against oxidative stress by catalyzing the reduction of hydrogen peroxide and various organic hydroperoxides to water and alcohols, respectively. This multifunctional enzyme exhibits the ability to reduce H(2)O(2) as well as short-chain organic, fatty acid, and phospholipid hydroperoxides. Additionally, PRDX6 possesses phospholipase activity, allowing it to either reduce the oxidized sn-2 fatty acyl group of phospholipids through peroxidase activity or hydrolyze the sn-2 ester bond of phospholipids through phospholipase activity. These functions are dependent on its binding to phospholipids at acidic pH and to oxidized phospholipids at cytosolic pH. Beyond its peroxidase activity, PRDX6 serves a critical role in phospholipid homeostasis and acts as an acyl-CoA-dependent lysophospholipid acyltransferase, facilitating the conversion of lysophosphatidylcholine (LPC) into phosphatidylcholine (PC). The enzyme exhibits a clear preference for LPC as the lysophospholipid and palmitoyl CoA as the fatty acyl substrate.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
O08709 (P2-P224)
-
Gene ID11758
-
Molecular Construction
-
N-term
-
PRDX6 (P2-P224)
Accession # O08709 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PRDX6; PRX; Peroxiredoxin 6; P29; AiPLA2; Red Blood Cells Page Spot 12; NSGPx; Lyso-PC Acyltransferase 5; AOP2; LPC Acyltransferase 5; Acidic Calcium-Independent Phospholipase A2; Antioxidant Protein 2; Lysophosphatidylcholine Acyltransferase 5; Liver 2D
-
AA Sequence
PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
-
Predicted Molecular Mass
31.7 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
