2. Search Result
Search Result
Results for "

Lewis rat

" in MedChemExpress (MCE) Product Catalog:

14

Inhibitors & Agonists

3

Peptides

1

Natural
Products

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-129630
    Tetrahydrocortisol

    		Microtubule/Tubulin Neurological Disease Cancer
    Tetrahydrocortisol is a cortisol metabolite that inhibits dexamethasone-induced formation of cross-linked actin networks. Tetrahydrocortisol can be used in the research of primary open-angle glaucoma, glucocorticoid-induced ocular hypertension, Lewis lung carcinoma, and EMT-6 mouse breast cancer .
    Tetrahydrocortisol
  • HY-B1214
    Prednisolone acetate

    Prednisolone 21-acetate

    		 Glucocorticoid Receptor Inflammation/Immunology Cancer
    Prednisolone acetate (Prednisolone 21-acetate) is an adrenocortical hormone active molecule with various pharmacological effects such as anti-inflammatory, anti-allergic, and immune suppression.
    Prednisolone acetate
  • HY-P5766
    AChRα(97-116)

    		nAChR
    AChRα(97-116) is a synthetic peptide corresponding to the 97-116 region of the rat acetylcholine receptor α-subunit, and also an inducer of autoimmune diseases. AChRα(97-116) can be used in studies related to experimental autoimmune myasthenia gravis .
    AChRα(97-116)
  • HY-P3023
    Mutanolysin

    		Bacterial TNF Receptor Infection Metabolic Disease Inflammation/Immunology
    Mutanolysin is a bacteriolytic agent. Mutanolysin is a muralytic enzyme that can prevent hepatic injury. Mutanolysin can digest the cell wall of S. mutans BHT and shows antibacterial activity. Mutanolysin reduces TNF-α production in isolated Kupffer cells stimulated with peptidoglycan-polysaccharide (PG-APS). Mutanolysin can be used for the researches of infection, inflammation and hepatic injury .
    Mutanolysin
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-12835
    S1P1 agonist III

    		LPL Receptor Inflammation/Immunology
    S1P1 agonist III is an orally active hS1P1 agonist with an EC50 value of 18 nM. S1P1 agonist III shows limited activity against hS1P3. S1P1 agonist III can be used in the research of multiple sclerosis .
    S1P1 agonist III
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-13496
    JNJ-28312141

    		c-Fms Inflammation/Immunology Cancer
    JNJ-28312141 is an inhibitor for colony-stimulating factor-1 receptor (CSF-1R or FMS), with an IC50 of 0.69 nM. JNJ-28312141 inhibits proliferation of BDBM, MV-4-11, M-o7e, TF-1 with an IC50s of 2.6, 21, 41 and 150 nM, respectively. JNJ-28312141 exhibits anti-inflammatory activity in mouse arthritis model .
    JNJ-28312141
  • HY-118488
    L 640035

    		Prostaglandin Receptor Cardiovascular Disease
    L 640035 is athromboxaneantagonist .
    L 640035
  • HY-163651
    (R)-Vorbipiprant

    (R)-CR6086

    		 Prostaglandin Receptor Inflammation/Immunology
    (R)-Vorbipiprant ((R)-CR6086) is an orally active antagonist for prostaglandin E2 receptor 4 (EP4) with Ki of 16.6 nM for human EP4. (R)-Vorbipiprant inhibits PGE2 (HY-101952)-induced cAMP production with an IC50 of 22 nM. (R)-Vorbipiprant exhibits immunomodulatory and anti-angiogenic activities, and ameliorates the collagen-induced arthritis in mice .
    (R)-Vorbipiprant
  • HY-13496A
    JNJ-28312141 hydrochloride

    		c-Fms Inflammation/Immunology Cancer
    JNJ-28312141 hydrochloride is an inhibitor for colony-stimulating factor-1 receptor (CSF-1R or FMS), with an IC50 of 0.69 nM. JNJ-28312141 hydrochloride inhibits proliferation of BDBM, MV-4-11, M-o7e, TF-1 with an IC50s of 2.6, 21, 41 and 150 nM, respectively. JNJ-28312141 hydrochloride exhibits anti-inflammatory activity in mouse arthritis model .
    JNJ-28312141 hydrochloride
  • HY-W110138
    Chloroxoquinoline

    		DNA/RNA Synthesis Cytochrome P450 ROCK Cancer
    Chloroxoquinoline is an anticancer agent. Chloroxoquinoline damages the DNA templates of cancer cells, inducing DNA breaks and cell death, and inhibits cell invasion via down-regulating Rho/Rho kinase signaling pathway. Chloroxoquinoline enhances the radiation sensitivity of Lewis lung cancer cells and xenograft tumors in tumor-bearing mouse models but decreases efficacy after long term exposure in rat models by auto-induction effects on CYP1A and CYP3A. Chloroxoquinoline has a broad-spectrum anticancer activity, such as non-small-cell lung carcinoma (NSCLC), breast cancer and gastric cancer .
    Chloroxoquinoline
  • HY-171296
    p38 Kinase inhibitor 8

    		p38 MAPK JNK Inflammation/Immunology
    p38 Kinase inhibitor 8 (Compound CCLXXVIII) is the orally active inhibitor for p38β and JNK2α2 with IC50s of 6.3 nM and 53.6 nM. p38 Kinase inhibitor 8 exhibits anti-inflammatory effect in rats collagen-induced arthritis models .
    p38 Kinase inhibitor 8
  • HY-181929
    RAI-20

    H018

    		 JAK Inflammation/Immunology
    RAI-20 (H018) is an orally active JAK1/JAK2 dual inhibitor (IC50=15.1 and 22.7 nM). RAI-20 exhibits excellent pharmacokinetic properties, including plasma stability, systemic exposure, and a long half-life. In a collagen-induced arthritis rat model, RAI-20 shows significant anti-inflammatory and anti-arthritic activities, effectively reducing paw swelling volume and arthritis index. RAI-20 can be used for research on the pathogenesis of rheumatoid arthritis .
    RAI-20

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: