Scientific Reviews
Product Guides
Blogs
Topics
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!2025-02-06
14 Results for "
Lewis rat
" in MedChemExpress (MCE) Product Catalog:
Products (14)
14 Results for "Lewis rat" in MCE Product Catalog:
Target:
Research Areas:
Prednisolone acetate (Prednisolone 21-acetate) is an adrenocortical hormone active molecule with various pharmacological effects such as anti-inflammatory, anti-allergic, and immune suppression.
Cat. No.: HY-P5766
CAS No.: 663154-30-1
Target:
Cat. No.: HY-P3023
CAS No.: 55466-22-3
Target:
Research Areas:
Mutanolysin is a bacteriolytic agent. Mutanolysin is a muralytic enzyme that can prevent hepatic injury. Mutanolysin can digest the cell wall of S. mutans BHT and shows antibacterial activity. Mutanolysin reduces TNF-α production in isolated Kupffer cells stimulated with peptidoglycan-polysaccharide (PG-APS). Mutanolysin can be used for the researches of infection, inflammation and hepatic injury .
Cat. No.: HY-P4191A
Target:
Research Areas:
Target:
Research Areas:
S1P1 agonist III is an orally active hS1P1 agonist with an EC50 value of 18 nM. S1P1 agonist III shows limited activity against hS1P3. S1P1 agonist III can be used in the research of multiple sclerosis .
Cat. No.: HY-P4191
CAS No.: 1883816-50-9
Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
Target:
Research Areas:
Cat. No.: HY-13496
CAS No.: 885692-52-4
Target:
Research Areas:
JNJ-28312141 is an inhibitor for colony-stimulating factor-1 receptor (CSF-1R or FMS), with an IC50 of 0.69 nM. JNJ-28312141 inhibits proliferation of BDBM, MV-4-11, M-o7e, TF-1 with an IC50s of 2.6, 21, 41 and 150 nM, respectively. JNJ-28312141 exhibits anti-inflammatory activity in mouse arthritis model .
Cat. No.: HY-118488
CAS No.: 77167-93-2
Target:
Research Areas:
L 640035 is athromboxaneantagonist .
Cat. No.: HY-163651
CAS No.: 2502965-92-4
Synonyms: (R)-CR6086
Target:
Research Areas:
(R)-Vorbipiprant ((R)-CR6086) is an orally active antagonist for prostaglandin E2 receptor 4 (EP4) with Ki of 16.6 nM for human EP4. (R)-Vorbipiprant inhibits PGE2 (HY-101952)-induced cAMP production with an IC50 of 22 nM. (R)-Vorbipiprant exhibits immunomodulatory and anti-angiogenic activities, and ameliorates the collagen-induced arthritis in mice .
Cat. No.: HY-13496A
CAS No.: 1149939-55-8
Target:
Research Areas:
JNJ-28312141 hydrochloride is an inhibitor for colony-stimulating factor-1 receptor (CSF-1R or FMS), with an IC50 of 0.69 nM. JNJ-28312141 hydrochloride inhibits proliferation of BDBM, MV-4-11, M-o7e, TF-1 with an IC50s of 2.6, 21, 41 and 150 nM, respectively. JNJ-28312141 hydrochloride exhibits anti-inflammatory activity in mouse arthritis model .
Cat. No.: HY-W110138
CAS No.: 23833-97-8
Target:
Research Areas:
Chloroxoquinoline is an anticancer agent. Chloroxoquinoline damages the DNA templates of cancer cells, inducing DNA breaks and cell death, and inhibits cell invasion via down-regulating Rho/Rho kinase signaling pathway. Chloroxoquinoline enhances the radiation sensitivity of Lewis lung cancer cells and xenograft tumors in tumor-bearing mouse models but decreases efficacy after long term exposure in rat models by auto-induction effects on CYP1A and CYP3A. Chloroxoquinoline has a broad-spectrum anticancer activity, such as non-small-cell lung carcinoma (NSCLC), breast cancer and gastric cancer .
Cat. No.: HY-171296
CAS No.: 815595-25-6
Research Areas:
p38 Kinase inhibitor 8 (Compound CCLXXVIII) is the orally active inhibitor for p38β and JNK2α2 with IC50s of 6.3 nM and 53.6 nM. p38 Kinase inhibitor 8 exhibits anti-inflammatory effect in rats collagen-induced arthritis models .
Cat. No.: HY-181929
CAS No.: 2549180-90-5
Synonyms: H018
Target:
Research Areas:
RAI-20 (H018) is an orally active JAK1/JAK2 dual inhibitor (IC50=15.1 and 22.7 nM). RAI-20 exhibits excellent pharmacokinetic properties, including plasma stability, systemic exposure, and a long half-life. In a collagen-induced arthritis rat model, RAI-20 shows significant anti-inflammatory and anti-arthritic activities, effectively reducing paw swelling volume and arthritis index. RAI-20 can be used for research on the pathogenesis of rheumatoid arthritis .
- 1
-
-
Protocols
Targeted therapy! The Capetin Prize winning "Click Chemistry" can be used like this!Targeted therapy! The Nobel Prize winning "Click Chemistry" can be used like this!A suitable model is crucial in drug screening experiments. Organs can mimic the three-dimensional functional structure of internal organs, have similar spatial organization to corresponding organs, maintain some key characteristics, and reproduce some physiological functions. They are widely used for modeling and personalized drug screening physiological functions.2025-02-06
