Insulin glargine
Based on 1 publication(s) in Google Scholar
Insulin glargine is a long-acting insulin analog. Insulin glargine has the effect of lowering blood sugar and can be used in the research of diabetes. In addition, high doses of Insulin glargine can promote the proliferation of bladder cancer cells.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 95%
- CAS. Nr.: 160337-95-1
- Formel: C267H404N72O78S6
- Molecular Weight:6062.89
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Insulin glargine
More
Biologische Aktivität
Insulin glargine (10-100 IU/L; 0-72 h) activates Akt in a PI3K-independent manner, thereby promoting the proliferation of bladder cancer cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:T24 bladder cancer cell
-
Concentration:0.1, 1, 10 and 100 IU/L
-
Incubation Time:72 h
-
Result:Promoted T24 cell proliferation at concentrations of 10 IU/L and 100 IU/L.
Did not affect cell proliferation at 0.1 IU/L and 1 IU/L.
Insulin glargine (450 mg/kg; subcutaneous injection; 6 months) has an improving effect in a mouse model of diabetes[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Seven-week-old male db/db mice[3]
-
Dosage:450 mg/kg
-
Administration:Subcutaneous injection (s.c.); 6 months
-
Result:Significantly improved glucose tolerance.
Upregulated pancreatic β-cell functional genes, such as INS1, Pdx1, Pax4 and Pax6.
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS. Nr. 160337-95-1
-
Appearance Liquid
-
Molecular Weight 6062.89
-
Formel C267H404N72O78S6
-
Color Colorless to light yellow
-
Sequence
A-chain: Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Gly; B-chain: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)
-
Sequence Shortening
A-chain: GIVEQCCTSICSLYQLENYCG; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Anal Chem
Ultrahigh Flow Regulated Discharge Coupling with Targeted Mass Spectrometry Analysis: Real Time Capturing Biomolecules in Exhaled Breath. [Abstract]2025 May 13;97(18):9827-9835. PMID: 40302637
Reinheit & Dokumentation
-
Data Sheet (266 KB)
-
SDS (419 KB)
- English - EN (419 KB)
- Français - FR (419 KB)
- Deutsch - DE (419 KB)
- Norwegian - NO (419 KB)
- Español - ES (419 KB)
- Swedish - SV (419 KB)
- Italian - IT (419 KB)
- Korean - KR (419 KB)
- Portuguese - PT (419 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Liu S, et al. High dose human insulin and insulin glargine promote T24 bladder cancer cell proliferation via PI3K-independent activation of Akt. Diabetes Res Clin Pract. 2011 Feb;91(2):177-82. [Content Brief]
[2]. Stammberger I, et al. Evaluation of the carcinogenic potential of insulin glargine (LANTUS) in rats and mice. Int J Toxicol. 2002 May-Jun;21(3):171-9. [Content Brief]
[3]. Li Y, et al. Comparative Study of Liraglutide and Insulin Glargine on Glycemic Control and Pancreatic β-Cell Function in db/db Mice. Med Sci Monit. 2018 May 19;24:3293-3300. [Content Brief]
[4]. Hwang HG, et al. Recombinant Glargine Insulin Production Process Using Escherichia coli. J Microbiol Biotechnol. 2016;26(10):1781-1789. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)