Phrixotoxin-1 TFA
Based on 1 Customer Validation
Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 96.46%
- Formel: C156H240N44O37S7.xC2HF3O2
- Molecular Weight:3548.30 (free base)
-
Speicherung:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Biologische Aktivität
Chemical Information
-
Appearance Solid
-
Molecular Weight 3548.30 (free base)
-
Formel C156H240N44O37S7.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Ala-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Ile-Ile-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
-
Sequence Shortening
YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Lösungsmittel & Löslichkeit
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Reinheit & Dokumentation
-
Data Sheet (283 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Benjamin Chagot, et al. Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004, 13, 5. [Content Brief]
[2]. Grit Schaarschmidt, et al. Characterization of Voltage-Gated Potassium Channels in Human Neural Progenitor Cells. PLoS One. 2009, 4, 7. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)