TDGF1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
TDGF1 Protein, Human (HEK293, His) is the recombinant human-derived TDGF1 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
TDGF1 Protein, Human (HEK293, His) is the recombinant human-derived TDGF1 protein, expressed by HEK293, with C-His tag.
The TDGF1 Protein, a GPI-anchored cell membrane protein, emerges as a key participant in Nodal signaling. Functioning as a Nodal coreceptor in cis, cell-associated CRIPTO, when shed by TMEM8A, dynamically modulates Nodal signaling by enabling soluble CRIPTO to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism contributes to the intricate regulation of Nodal signaling pathways. Moreover, TDGF1 is implicated in the determination of epiblastic cells, which subsequently give rise to the mesoderm, underlining its significance in early developmental processes. Notably, TDGF1 interacts with the activin type-1 receptor ACVR1B, further underscoring its role in mediating critical cellular signaling events.
Immobilized human TDGF1 at 2 μg/mL (100 μl/well) can bind human ALK4 with a linear range of 0.0068-0.16 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
AAH22393.1 (L31-T172)
-
Gene ID6997
-
Protein Length
Partial
-
Synonyms
CRIPTO; Cripto-1 Growth Factor; Prev. TDGF1; Cripto-1; Teratocarcinoma-Derived Growth Factor 1; CRGF; CR-1; Growth Factor; CR; CRIPTO-1; Epidermal Growth Factor-Like Cripto Protein CR1; Cripto, EGF-CFC Family Member; Protein Cripto
-
AA Sequence
LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)