TDGF1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TDGF1 Protein, Human (HEK293, His) is the recombinant human-derived TDGF1 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TDGF1 Protein, Human (HEK293, His) is the recombinant human-derived TDGF1 protein, expressed by HEK293, with C-His tag.

Background

The TDGF1 Protein, a GPI-anchored cell membrane protein, emerges as a key participant in Nodal signaling. Functioning as a Nodal coreceptor in cis, cell-associated CRIPTO, when shed by TMEM8A, dynamically modulates Nodal signaling by enabling soluble CRIPTO to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism contributes to the intricate regulation of Nodal signaling pathways. Moreover, TDGF1 is implicated in the determination of epiblastic cells, which subsequently give rise to the mesoderm, underlining its significance in early developmental processes. Notably, TDGF1 interacts with the activin type-1 receptor ACVR1B, further underscoring its role in mediating critical cellular signaling events.

Verified Bioactivity

Immobilized human TDGF1 at 2 μg/mL (100 μl/well) can bind human ALK4 with a linear range of 0.0068-0.16 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    CRIPTO; Cripto-1 Growth Factor; Prev. TDGF1; Cripto-1; Teratocarcinoma-Derived Growth Factor 1; CRGF; CR-1; Growth Factor; CR; CRIPTO-1; Epidermal Growth Factor-Like Cripto Protein CR1; Cripto, EGF-CFC Family Member; Protein Cripto

  • AA Sequence

    LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART

  • Predicted Molecular Mass

    17.4 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00