PLBD2 Protein, Mouse (His)
PLBD2 Protein, a putative phospholipase, interacts with insulin-like growth factor 2 receptor (IGF2R), suggesting involvement in growth and signaling pathways. Despite unknown details about its phospholipase activity, PLBD2's exploration may unveil insights into its role in cellular homeostasis and regulatory mechanisms. PLBD2 Protein, Mouse (His) is the recombinant mouse-derived PLBD2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PLBD2 Protein, a putative phospholipase, interacts with insulin-like growth factor 2 receptor (IGF2R), suggesting involvement in growth and signaling pathways. Despite unknown details about its phospholipase activity, PLBD2's exploration may unveil insights into its role in cellular homeostasis and regulatory mechanisms. PLBD2 Protein, Mouse (His) is the recombinant mouse-derived PLBD2 protein, expressed by E. coli , with N-His labeled tag.
PLBD2 protein, identified as a putative phospholipase, exhibits interactions with insulin-like growth factor 2 receptor (IGF2R). The precise nature of its phospholipase activity and its potential implications in cellular processes remain areas of interest, as the protein's interaction with IGF2R suggests a role in pathways associated with growth and signaling. Further exploration of PLBD2's functional characteristics may provide insights into its contribution to cellular homeostasis and regulatory mechanisms.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
Q3TCN2-1 (L47-D594)
-
Molecular Construction
-
N-term
-
His
-
PLBD2 (L47-D594)
Accession # Q3TCN2-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
PLBD2; PLBL2; Phospholipase B Domain Containing 2; Phospholipase B-Like 2 32 KDa Form; P76; Phospholipase B-Like 2 45 KDa Form; Lamina Ancestor Homolog 2; Putative Phospholipase B-Like 2; LAMA-Like Protein 2; PLB Homolog 2 (Dictyostelium); Mannose-6-Phosp
-
AA Sequence
LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
-
Predicted Molecular Mass
65.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
