ETF1 Protein, Human

ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.

Background

RF1 is a component of the eRF1-eRF3-GTP ternary complex, which mediates translation termination in response to stop codons. The complex binds to a stop codon in the ribosomal A-site, with ETF1/ERF1 responsible for stop codon recognition and peptidyl-tRNA hydrolysis. Following GTP hydrolysis, eRF3 dissociates, allowing ETF1/eRF1 to fully occupy the A-site and facilitate peptidyl-tRNA hydrolysis. RF1 is also part of the transient SURF complex, recruiting UPF1 to stalled ribosomes during nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Additionally, RF1 is required for SHFL-mediated translation termination, which inhibits programmed ribosomal frameshifting (-1PRF) in viral and cellular mRNAs. by similar: Functional mechanisms of the eRF1-eRF3-GTP complex and its role in translation termination.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    ETF1; Eukaryotic Peptide Chain Release Factor Subunit 1; Prev. ERF1; Polypeptide Chain Release Factor 1; Prev. SUP45L1; Protein Cl1; Prev. ERF; Eukaryotic Release Factor 1; TB3-1; D5S1995; RF1; Eukaryotic Translation Termination Factor 1; Sup45 (Yeast Omn

  • AA Sequence

    SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL

  • Predicted Molecular Mass

    14.8 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00